SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005070 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005070
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-49
Family Ankyrin repeat 0.000074
Further Details:      
 
Domain Number 2 Region: 225-265
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000209
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005070   Gene: ENSGACG00000003863   Transcript: ENSGACT00000005085
Sequence length 274
Comment pep:novel group:BROADS1:groupXVI:8811805:8814735:1 gene:ENSGACG00000003863 transcript:ENSGACT00000005085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLESDWSPIHEAAFNGRVLTLQRLIAQGTCVNLNTLDQVSPLHGACLQGHVACATLLM
ENAANVNGSTVDGQTPLSEACARGHVTCVSLLLHHGATPLGSTPTSSPIHRAAAKGHPEC
IQPLVEHGADVDQHIAQCGSPLSVACSNEHLSAVRKLLQLGASVNGAVSGDSPLHIAAGL
SNPELVSVLLDHGADRGLRNSEGKQPADLAPPNSRAQRLLRQAGGASPLMQLCRLHIRRT
VGKQRLGGIQDLPLPTEVKQYLLYQSDPAGEPAH
Download sequence
Identical sequences G3NIB0
ENSGACP00000005070 ENSGACP00000005070 69293.ENSGACP00000005070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]