SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005104 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005104
Domain Number 1 Region: 4-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.83e-42
Family Ankyrin repeat 0.0000841
Further Details:      
 
Domain Number 2 Region: 373-424
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000536
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005104   Gene: ENSGACG00000003890   Transcript: ENSGACT00000005119
Sequence length 433
Comment pep:novel group:BROADS1:groupXVII:1367496:1370486:-1 gene:ENSGACG00000003890 transcript:ENSGACT00000005119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NASFLLQRGAEADSEDQDQDTPLLLVHEAARLGKTELVSLLLEAGALTDPRSRDGLTPLA
LAAQAGRREVVETLLRRGKSPLVRPAGADVLSQAQDEASILYEASSSGDPEVVGLLLDFG
ADANVAKQTGHLPLHRVAHRGHLQALKLLIPVTSKAEVEDSGISPLHSAAAGGHPDCIKA
LLDAGYDPNYMLHPWVQRSYDDERKSALFFAVLNNDVPSAKLLLEAGAMANQDPIKCLQI
SLRVGNYELINLLLRFGANVNYYCRINTTHFPSALQYALKDEVVLRMLCNYGYDVERCFD
CPYGNGSHVPEDYEGWSNSVIKDTMFCEVITVRWLKDLSGQLVRVMLDYLDHVPLCSKLK
AAVMEQRQWPDICRLQENARPLQHLCRLRIRRCLGRLRLRSPVFMSFVPLPGRLKDYVMY
REYDLYGRQGGVR
Download sequence
Identical sequences G3NIE4
69293.ENSGACP00000005104 ENSGACP00000005104 ENSGACP00000005104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]