SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005243 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005243
Domain Number 1 Region: 40-154
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.62e-21
Family Frizzled cysteine-rich domain 0.00081
Further Details:      
 
Domain Number 2 Region: 173-284
Classification Level Classification E-value
Superfamily TIMP-like 0.0000534
Family Tissue inhibitor of metalloproteinases, TIMP 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005243   Gene: ENSGACG00000003997   Transcript: ENSGACT00000005258
Sequence length 299
Comment pep:novel group:BROADS1:groupXIX:5387889:5389298:1 gene:ENSGACG00000003997 transcript:ENSGACT00000005258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLKSCIPPPRRISQMAVFFAVALLAVTCPSMAFDMGQSTRCVTIPNRMKVCKDVGYSEM
RLPNFPGSQQPGTLRWCPVQRTGGLCCRPGCHPQAQTFLCSLIAPVCLDTFIRTCGSLCV
AVRDSCAPVHACQGHPWPAALDCDRFPAEEDMCLSPHAKSNYFTKGIPKVACQNCPSVEE
APAVKTVLDSFCQHDFAVTAKLHRRRSPAGEPEYEIDGRVEFIRQGPLLPYDTQHLLQQW
LLINLGCANGLVRPGRSQLCVLTGSVQHDGTLALTRVFPWNKKDASIAAATRKWKHHRC
Download sequence
Identical sequences G3NIT3
ENSGACP00000005243 ENSGACP00000005243 69293.ENSGACP00000005243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]