SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005356 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005356
Domain Number 1 Region: 260-471
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.87e-60
Family Reprolysin-like 0.00075
Further Details:      
 
Domain Number 2 Region: 558-615
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000785
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 1355-1414
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 1210-1269
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000654
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 1079-1140
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 1025-1083
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000109
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 7 Region: 1161-1212
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 8 Region: 1305-1358
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 1469-1529
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 964-1026
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 11 Region: 1653-1703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 1528-1587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 13 Region: 1420-1473
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000562
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 14 Region: 1590-1651
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000105
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005356
Domain Number - Region: 853-906
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0017
Family TSP-1 type 1 repeat 0.0071
Further Details:      
 
Domain Number - Region: 904-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0262
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005356   Gene: ENSGACG00000004063   Transcript: ENSGACT00000005371
Sequence length 1910
Comment pep:novel group:BROADS1:groupXIX:5536933:5596257:1 gene:ENSGACG00000004063 transcript:ENSGACT00000005371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFAIWLVGLMCHLSALVRDTLQHPLHPKQESFIKQLSSYEIITPVRVNDFGESFPHKLH
YRRRRRSLNEDLSGLRVHYRIDAFGDRFHLNLTAESGFIAPSYTVTHLGAERSGGAAADP
HLGDHRSDMRHCFFRGQVNGEGAYPAVFSLCTGLIGTFTTQHGEYFLEPLLNAAGEEYDE
EHNKPHLVYRHERKRNVSHPDNHTEHCAAPETERSERPAALQSRWSMGEELDALRSVAAD
GHIRDDNSTEAPRRRKRFLSYPRYVELMVTADAKMARHHGRNLEHYILTIMSVVAAVYKD
PSVGNLINIMIVKLVIVHNEQEGPTVSFNAATTLHNFCVWQQSQNFQDDSHPSHHDTALL
ITREDICRAKDKCDTLGLAELGTMCDPYRSCSISEENGISASFTIAHELGHVFNMPHDDN
PKCREAGLKHQYHVMAPTLNYDTNPWSWSKCSRKYITEFLDTGYGECLLDEPGGRTYELP
TLLPGQTYNANRQCELMFGPGSQICPYMKQCKRLWCTSAEGDHKGCRTQHMPLADGTDCG
HGMYCKHGMCVNKEFDLQPVHGEWGPWGPYSVCSRSCGGGTRSTARDCNKPMPRNGGKFC
VGRRMKFRSCNTEPCPRGQKDFREEQCSHFDGKHFNINGLPPTVRWVPKYSGILMKDRCK
LFCRVAGTMAYYQLKDRVTDGTPCGTDTYDICVQGLCRQAGCDHVLNSKARNDKCGVCGG
DNSSCKTLSGTFNDAQYGYNTVVRIPAGATNIDIKQVSYSGKPEDDNYLALSDNQSNSVL
NGNFVVAMFKREITFKGTVIDYSGSDTPVERINCTDRIQDELVLQVLCVGNLHNPDVRYS
FNIPIEEHGEQFVWEPSGSWLDCNRICQGERRRTAVCVRRSDHLEVSDQRCEHLPRPVAV
AEPCNPDCEVRWHVAGKSECSAKCGPGYRSLDVQCMKYSLRKRQSDRVEASTCGDAAKPQ
TREPCHGDCLLTSWQYSAWSQCSKTCGRGSRSRESYCMNNRGRRLVDRECGEYQRLVTET
CSEQPCPEWTESEWSECPVTCGKGTRHRQVSCSIGAGQEELGEHLCDPSSKPASVGGCEL
PDCASWQVGVWGGCAVTCGHGYQMRAVRCVSGEYGATVDDRECNAAARPRDTQDCETQPC
PWASPVHSTTRPDNFARILTQWRYGSWTACSVSCGKGKRERYVSCRDARGGVADESHCTH
LPRPPESSACFSPCGQWRAGEWSPCSVTCGVGRTTRQVVCSNYHQPVDRSFCDPEEQTVT
EQECTAAPCPSVHHRQRINDQPYGYPQDPGRHPGHSSWNVPSADNQWRTGPWGACSSTCA
GGFQRRVVVCQDADGRSNSYCDERVKPDESKGCDSGPCPVWNFGVWGECTQTCGGGRRTR
LVVCQRPNGQMLNNYNCDILDKPPDMEQCNLQPCPGSASWLRRPWKPCSVSCGRGTKQRQ
IACVYQNQSQIAEEHCGHLPRPRTQKSCRARGCPSWKANRWTECSVTCGVGVQNRRVYCR
LKGTGQVREDLCGAHLRLAAVRPCQTAECTHYSWVAGEWEECNATCGEGRRSRKVGCMGP
GITPVQVDYCEPSSQPPSHQPCQGAPCHHTWTTGQWSQCSASCGVGYQQRAASCSVMPSS
QARRPYAAASSSTRCPEPQPPGSRPCLLRDCPHTTYWKVGPWSKCSQTCGAGVMERRVEC
VTPKGQPSKHCRPSGRPESQAACQDTECQLFASCRDVQMRLGVKIDGEYHLKVKSRILQI
YCAEMQTDFPKEYVTLRSGQTDNYSEVYGNRLLNPFECPFNGSRRQDCDCRNDYSAAGYT
LFHKVRVDLSSLRIMITDLQFSQTLLGRPVPFGTAGDCYSAAKCPQGQFSINLIGTGLKV
AEETKWTSQGNYVSIKVHRSEDGTRIYGRCGGFCGKCIPQANNGLLLQVH
Download sequence
Identical sequences G3NJ46
69293.ENSGACP00000005356 ENSGACP00000005356 ENSGACP00000005356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]