SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005451 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005451
Domain Number 1 Region: 364-574
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.35e-67
Family Eukaryotic proteases 0.00000136
Further Details:      
 
Domain Number 2 Region: 100-205
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-31
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 3 Region: 206-300
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-28
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 4 Region: 32-77
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000701
Family Fibronectin type I module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005451   Gene: ENSGACG00000004146   Transcript: ENSGACT00000005467
Sequence length 578
Comment pep:novel group:BROADS1:groupXIII:1574250:1586065:1 gene:ENSGACG00000004146 transcript:ENSGACT00000005467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTLILLLSALCCCLAVNVELLRSKRGTRFYRVHCVDAETSAVRIFGDTWLRWRGQRVE
YCRCALKGRERCHIVPVINCYVSQCYNGGTCKEAVYTSDYICQCPAGYSGTQCEINSNEK
CIVGQGEGYRGTWSISHSGAQCINWNATSLRGRRFTARKVDASGLGLGNHNFCRNPDHDS
TPWCYIYKGTQITWDFCSITKCPEDDYKECLRGSGRSYRGTASVAKSGSRCLPWDSPAVK
HKLNNAWRSDALDKGLGSHSFCRNPDGDAGPWCHTYKSMQLTWELCDIPKCSRRPSISST
LGPRAPTTNNNNGVVGKTTRLKSPVVPHVRVVERTDIPEQPMAGGHKCFPRPSTESIFPP
AEESLIDSCWVLSAAHCFEDNDKAEKLEVILGRTFRKQNSSSEQIFKVEKYWNHEKFHNE
TFDNDIALLKLKTDIGICAVNSPEVLPACLPERGLVLPDWTECEISGYGKDFEFAAEFSE
RVKRGFVRLWPKERCVPDVLSQRTITSNMLCAGDTRGLDDACKGDSGGPLVCRNNDKMTL
MGVISWGDGCGQRDKPGVYTRVTHYIDWIKSKIKANPV
Download sequence
Identical sequences G3NJE0
ENSGACP00000005451 ENSGACP00000005451 69293.ENSGACP00000005451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]