SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005500 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005500
Domain Number 1 Region: 337-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 2 Region: 774-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 870-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000156
Family Laminin-type module 0.0038
Further Details:      
 
Domain Number 4 Region: 933-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 5 Region: 824-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 981-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.0023
Further Details:      
 
Domain Number 7 Region: 1560-1777
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000255
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number 8 Region: 460-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 9 Region: 273-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 10 Region: 413-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000198
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 11 Region: 512-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 12 Region: 1090-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 13 Region: 1033-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 14 Region: 1138-1186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000246
Family Laminin-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005500
Domain Number - Region: 1225-1347
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.012
Family CorA soluble domain-like 0.0065
Further Details:      
 
Domain Number - Region: 109-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0478
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005500   Gene: ENSGACG00000004167   Transcript: ENSGACT00000005516
Sequence length 1793
Comment pep:novel group:BROADS1:groupXII:3580206:3601894:-1 gene:ENSGACG00000004167 transcript:ENSGACT00000005516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSPSALLPAGFLSTESVLATAVGQEPDHSHGCAQGSCYPATGDLLVGREKNLKASSTCGM
RRKEPYCIVSHLQDEKKCFDCDSRRPYDPVYNTINHRVENVITTFKPHRKKSWWQSENGK
SDVFVQLDLEAEFHFTHLIMTFKTFRPAAMLIERSADFGRTWQIYRYFSHDCTAAFPGVP
QGPSRNINDVLCESRYSDIEPSTGGEVIYRVLDPSIRIEDPYSPSIQNQLKITNLRVNFT
KLHTLGDNLLDPRDEIKEKYYYAMYELVVRGNCFCYGHASECAPIVGIRDDIEGMVHGRC
VCNHNTKGLNCERCDDFHNDLPWRPAEGRSTNACKKCNCNGHSSQCHFDMAVYLATGNLS
GGVCDDCQHNTMGRNCETCKLFYYKDPVKDTRDPQVCIACDCDPDGSQNGGMCDSHTEPS
LGLVGGQCRCKANVEGPRCDKCKTGFFGLSPHNPQGCQPCQCDHRGTVSGSSQCDPVSGD
CFCKRLVTGRSCDQCLPEHWALSHDLNGCRGCECDVGGALDNHCSMQSGQCRCRSHMTGR
QCTQVESRYFFMALDHFLYEAESAKMGQGCTPETREHQPGRPATWTGSGFARVPEGGTLE
FLIADIPYSMEYELLIRYETQMPRDWEDVQITVIRPGPIPTSSPCGNTIPDDDRLTVSLP
AAARFVVPAPAVCLERGVTYTLRFEFKRYQDANSILHGAAEALLLMDSIALMPRHTSMEM
FNAGDTASSSRKQAYERYRCREGAKSVTRPMMTDTCAKLILSMSAIINDGALACNCDPQG
SVSSMCDVRGGQCACKPNVIGRRCDQCAPGTYGFGPSGCIGPACSCSLEGAVTRLCDKFS
GQCQCRPGAFGQRCDGCQAGHWGFPSCRPCRCNGHADQCDQRTGACVSCRDNTGGDKCDR
CANGYYGNPVLGKASSAQCRPCPCPEGPNSGRHFAASCYQDNRDRQIICNCNQGYTGARC
EECAPGYYGNPSRPGGRCQPCQCNNNIDMSDMEACDRQTGQCRKCLYNTEGPDCGICKSS
YFGDASRRNCRKCTCNFLGTDRGQCMEREDCVCQRASGQCQCQPNVIGLPCDHCAPNHWN
LASGRGCEPCGCDPHNSVTAACNEFTGKCQCRDGFGGKTCTDCQENYWGDPRTQCRACDC
DWRGIETSQCNRVTGHCVCQQGVSGVRCDQCARGFSGHFPNCQPCHKCFGDWDRIVQDLA
VRTKTLAERAHEIQTTGLTGVYEKAFRDLEEKLAQARGIVNARNATAVAVTTLMELIEDL
RAQIGETTDALSRLEGDLTIVQDGNSEASKELSALEREAKELNLTLKQLHRQLDILKNSN
FLGAYDSIRSSHNKSRDAERRANESTTTRPSTVSQSADTRHRTERLIAAKKDDFNRKNAA
NKRALGDLNTRAQGLDLKKINEKVCGAPGDAPCGESPCGGAGCRDDEGNRHCGGLNCNGA
VAVANNAMERAKHAEKELNKAMGEVEGLFSKVADAKTKAEEAKGKAQAALDKATATKNKV
ERSNNDLRDLIKQIRDFLTQEGADPDSIEAVANRVLELSIPASPLQIRHLADEIKERVHS
LSNVDAILQQTQDDVRRAERLLLDAKRARHSAEGVKTTAETVKQALVDAQTAQASAEKAI
ARAKADIGETQTRLTQIESETSNSEKDLDDAMERLATLGREVSALKTKRANNSMAAARAE
ETATMARDKANEAKQILDGQLTDKYHEVQQRVDTKAKVVQDAKKRAEHLRHEAKELLRDA
QNKLQRLAELEKNYEDNQKKLEGKARQLDGLEDQMKAILSGINKQIQIYNTCQ
Download sequence
Identical sequences G3NJI9
ENSGACP00000005500 69293.ENSGACP00000005500 ENSGACP00000005500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]