SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005553 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005553
Domain Number 1 Region: 107-155
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005553
Domain Number - Region: 69-104
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00017
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005553   Gene: ENSGACG00000004218   Transcript: ENSGACT00000005569
Sequence length 286
Comment pep:novel group:BROADS1:groupXIII:1669763:1680964:1 gene:ENSGACG00000004218 transcript:ENSGACT00000005569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGSTGSLPRNSASSGQDHRGNFSVMGARGWSSPRLGWFVVWGYLAFLVPRAEAGCGERES
PNCCTGRNNECFEYSERKTACYCDTYCQKTGDCCEDYRRVCQMSAAIDCVVGSWGPWSPC
TSPCGVGSTERIRQVSVPPRNGGTPCPDLKQRRGCFGNNAICSSAKEVAKILPDSFKRNF
KDPWRRPHMLMKEEKASYCVYLRVKQASAACRLKLWSAQLVRERLVCAECQSDAMSKSDH
CGGDGLESTSTRTFWAAASVPGCHGSWVRELSSDGCRCPPYSVLFV
Download sequence
Identical sequences G3NJP1
ENSGACP00000005553 69293.ENSGACP00000005553 ENSGACP00000005553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]