SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005679 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005679
Domain Number 1 Region: 67-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-49
Family Astacin 0.0002
Further Details:      
 
Domain Number 2 Region: 423-597
Classification Level Classification E-value
Superfamily TRAF domain-like 9.16e-33
Family MATH domain 0.0022
Further Details:      
 
Domain Number 3 Region: 265-426
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-28
Family MAM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 642-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005679   Gene: ENSGACG00000004292   Transcript: ENSGACT00000005695
Sequence length 734
Comment pep:novel group:BROADS1:groupXVIII:908510:914785:-1 gene:ENSGACG00000004292 transcript:ENSGACT00000005695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRDSLSQIAALVGVLVALTVGAFGIQRDYADAGELRDDILEINRGLNQLFEGDIAIDS
SRNAILDQKRRWKFPIPYILTDSLELNAKGVILQAFEEYRLRSCVDFKPYEGESSYVSFT
KLSGCWSYVGDDRTGQNVSIGAGCDTKAIVQHELLHALGFYHEQSRSDRDNYVKIWWDQI
EEGKKHNFNKYEDDFITDLNTPYDYESIMHYRPLSFNKNDSIPTITTSIPYFNEVIGQRL
DFSAVDVSRLNRMYDCANTLTLLDQCSFELNNICGMIQNEEDNADWVQTLSSPADTDHTM
AGLCRDSGYFMKFDTSSGPVGSSALLESRILYPKRDEQCLQFFYKMTGAAGDKLVIWIRT
DDGTGTVRSIRKIHTITGSGDAAWKMAYVTLKVSGKFRYFFQGVRGSSGSSGAVSIDDIT
LTETICPSSVWQIHNFTGILASTPPGGLLKSKCFFNSEGHSFGISVYPNGRESGYPDYVG
IALHLCSGENDAVVQWPVKNRQATIVAVDQDPDVKLRMSSTRSFTTGKSRLLADFENLMY
TDPRWNRPTAASGAEWDVGCQCFRRKDFGWSTFISHKHLHSRSFLKENDFIITVNFNDLT
HLIQTEVDVEPASPGSDVPNEEPISEVEMRPEVSKHREARAADPCRPNPCSNGGVCVERD
GRVSCRCASTQTTIYTGKRCEEVSVHIGVVGALIAGAAGTVILTLAIFTVLRGARCLLHS
FGSAITEENVGILL
Download sequence
Identical sequences G3NK17
ENSGACP00000005679 ENSGACP00000005679 69293.ENSGACP00000005679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]