SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005719 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005719
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.69e-40
Family Protein kinases, catalytic subunit 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005719   Gene: ENSGACG00000004334   Transcript: ENSGACT00000005735
Sequence length 462
Comment pep:novel group:BROADS1:groupV:5077980:5082926:1 gene:ENSGACG00000004334 transcript:ENSGACT00000005735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKPACLAQLLKDMSSLPEDLALHYFHQSLGALEHLHHRKVLHLDVKVDNMLLSADCRD
TFLCDFGLSETLDDSGRSFSAFRGAAFPGTESHMAPEVARGDPLSAKADVWSSCCMLLHM
LNGCPPWTRYYSPPLCLQIVNQPAPLWEVPSNCNNFTAKVFRAGLQKDPDRRASAKELRR
KSTKALRAVGGLSAWSVKSARNNLRNDGSQDEDSVCPSTPGINPTTTPAPIYWTPLYNSQ
KEVSPEIGLLARHEENPRRTRLSPEHGWIESTPETGQTPAAVPQQDGQSETIEAVIGTAI
QTPSPEPRDDPPSCFSCSDTSQMDASDKSPLLSKESDRSSDDLSSGVFSSCNSRTEGHLE
WSASANQPSSYCFEGVDIWIENVQGECLRIRERRQVKVGHVAIGISEQVSGKAFTLETLD
RKAVSFELEIRESCLWLRCVPAPDRCQSWRWRVTDGKLELRE
Download sequence
Identical sequences G3NK57
ENSGACP00000005719 69293.ENSGACP00000005719 ENSGACP00000005719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]