SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005734 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005734
Domain Number 1 Region: 192-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.46e-54
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.04e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0017
Further Details:      
 
Domain Number 3 Region: 93-183
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000447
Family Double-stranded RNA-binding domain (dsRBD) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005734   Gene: ENSGACG00000004345   Transcript: ENSGACT00000005750
Sequence length 497
Comment pep:novel group:BROADS1:groupVI:5059988:5066194:-1 gene:ENSGACG00000004345 transcript:ENSGACT00000005750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVARLNELTQKQRLVVRYEDVGCVGLDHIKTFTVRAVVDGKPYPDGVGKNKKEAKLNAA
ANALTVLLEETIDPTENATEASTASAAQTVLSQGNYMCWLNEYSQKNRMMIRAVESTQLV
PNGLSLCCCYFVVGDKEYPRATGKTKKEAKEEAAKLVFQQIHGIETTEDVVKDQNTGNSQ
NETSIQSSCVDPSRFTSKFEDIEWLAKGVFGDVYKAREKLLEKYFAVKIVRSETKAFREA
DTLSDLHHNNIVRYFTSWMEDSKYQGNPESTDSSAESSAGYSSSQSTDDSAAKYLYIQLE
LCDTKTLKDWIGQKNNESVQDSKRREEGLSIAQQIVSGVEYIHSKRHIHRDLKPPNILFG
LAGGVKIGDFGLVTTDDDEDALIDRTADSGTCPYMAPEQSKKNYDRKVDIFAMGLIFLEI
LWKVSSGHERAEIFRDAKCQKLPTEFLQTYPQEMLIIKSMLRENPEKRPEATEVKAELEK
CVSTFNAQSLPQRNATV
Download sequence
Identical sequences G3NK72
ENSGACP00000005734 69293.ENSGACP00000005734 ENSGACP00000005734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]