SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005778 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005778
Domain Number 1 Region: 26-159
Classification Level Classification E-value
Superfamily C-type lectin-like 2e-17
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 324-432
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005778
Domain Number - Region: 244-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00015
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 286-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00642
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005778   Gene: ENSGACG00000004379   Transcript: ENSGACT00000005794
Sequence length 491
Comment pep:novel group:BROADS1:groupXVIII:960965:963118:1 gene:ENSGACG00000004379 transcript:ENSGACT00000005794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VITVLLLLYISPDTRGAAQMEPCRARCSGTRCFAAFHRAADSTAARDGCADLGGHLMTVR
SSSIHDILPFLLGNLTGRFWIGLHLATGCPDPAAELRGFRWATGEVGSEFTHWPAAFDGS
CSSPRCVSVSQEDDFEWVQGPCGDRLAGFLCEHGLGDPCEARTDARGAAPVYTPAAGSSP
PGSTAVRTPPDTKYFCVSGRWQPAPRSCGAHEGVCERRCAENPERAPSPDPPTGTDDPCV
ALDCAQGCHKDGRASACTCGHGFKLARDGRSCVHVDDCADERRCTGENSVCVSNSVGGSR
CVCEDGYKSRSGRCVDVDECASAPCEHKCANTPGSYECGCFPGYKKDPKSPHTCALFCGE
EECAAECDPNNRFQCFCPDGYVADERGGDTVCTDIDECSSDYCDDLCRNTFGSYVCACSP
GYTLVDQFRCVKNEGPTDEEPEGSGEATSQSFPTTTTATARPEPPRRPSAVSAGGLAGII
VCTVFFSLLML
Download sequence
Identical sequences G3NKB6
ENSGACP00000005778 ENSGACP00000005778 69293.ENSGACP00000005778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]