SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005931 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005931
Domain Number 1 Region: 431-561
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 623-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000354
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 3 Region: 776-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000061
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 4 Region: 648-780
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000135
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 332-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000305
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 368-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000887
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 7 Region: 811-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 8 Region: 294-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000362
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 848-906
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000178
Family VWC domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005931
Domain Number - Region: 406-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000746
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 588-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000937
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005931   Gene: ENSGACG00000004493   Transcript: ENSGACT00000005948
Sequence length 1219
Comment pep:novel group:BROADS1:groupVI:5204637:5226996:-1 gene:ENSGACG00000004493 transcript:ENSGACT00000005948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILRRGSVVAAFLLCFLAKVSEGSGQFELQVLSMHNANGELLSGACCDGPRDAAERKCTR
DSKCDTFFKVCLKEYQSRVSAAGPCSFGMGSTPALGGNTFSFKSPVRNDRSRIVLAFSFA
WPRSYTLIVEALDSNNETSGADGRLIEKASHSGMINPSPQWQKLTHNGPVAQFEYQIRVS
CDEHYYGFGCNKFCRPRDEFFGHYTCDYNGNKTCLEGWSGSDCNTAICRQGCSTEHGSCK
EPGECKCLYGWQGQYCDKCIPHPGCVHGTCGEPWQCLCDTNWGGHLCDKDLNYCGTHQPC
LNGGTCINTGPDKYQCTCAEGYSGANCERAEHACLSNPCSNGGSCSETSQGYECQCAAGW
SGPSCTINVDECSPTPCNHGGTCQDLVNGFKCHCPSQWSGKTCLIDANECDSKPCVNANS
CRNLIGGYFCECVPGWTGQNCDIDVNDCKDQCQNGGTCKDLVNDYRCTCPPGFAGEHCER
DVDECASGPCLNGGRCQDEVNGFQCLCLAGFSGNLCQLDIDYCSPNACQNGAPCFNLATD
YFCACPEDYEGKNCSHLKDHCRITTCKVIDSCTVAVASNSTPGGERYISSNVCGPHGRCR
SQAGGQFSCECKEGFRGTYCHENINDCESNPCRNGGTCIDKVSVYKCICGDGWEGDHCEI
NIDDCSTNPCHNGGTCRDLVTDFFCECKNGWKGKTCHSRESQCDEATCNNGGTCHDEGDT
FQCKCSPGWEGTTCLSAKNSSCLPNPCENGGTCVVTGESFTCVCKEGWEGPTCTQNTNDC
SPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCALGSSCVDEINGYRCLC
PAERTGPHCQEVTRKPCSVNGHVTPDGLKWDEDCNTCQCLNGKVLCTKMWCGPASCHLGA
KGRGGCLSGQSCVPIREGHCFVKPCVDLGECWHSNPPPPPTKCHPSSSYQENSCANITFT
FNKETLPQGLTVEDVCKQLRRLYAVKNFSSEDSVSITCDPSFSASNEIHVCISTEDHCLD
RSPVKEITDRIIDLVSKRNGNNTIIAAIVEVRVPSASKTASDYLVPLLSSIFIVIWVLVL
VSILLWCMRRRRKQSNHSGTSAPSAEDNTTNNVREQLNQIKNPIEKHVGLAVAIKDYENK
NSIIAKIRTNHPEGDEDDKERHLQKGRFAKQPAYTLVERDEKTPVSNPNSTSKHPNWTNK
QDNRDLETANSINRMDYIV
Download sequence
Identical sequences G3NKR8
69293.ENSGACP00000005931 ENSGACP00000005931 ENSGACP00000005931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]