SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005948 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005948
Domain Number 1 Region: 181-392
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.81e-57
Family Reprolysin-like 0.00042
Further Details:      
 
Domain Number 2 Region: 478-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000837
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 1381-1441
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 1227-1276
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 887-935
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000693
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1330-1384
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 816-882
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 765-821
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000249
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005948
Domain Number - Region: 1271-1335
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00602
Family TSP-1 type 1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005948   Gene: ENSGACG00000004500   Transcript: ENSGACT00000005965
Sequence length 1483
Comment pep:novel group:BROADS1:groupXIII:1875818:1881083:1 gene:ENSGACG00000004500 transcript:ENSGACT00000005965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVHPVKTTADGEFVSHSVAHHSEGGRTRRDLRPLDSDAQVYYKVDHGGHSLMFNLTANVG
LLSNNYVLERRNGAASRTEHRRSAGRTCHLLGTVEAPGVRGTAAISTCEGLRGFFSLPEG
HFFIEPVQRSPDDPAGTPEPHIVYSRVPTGRQRNKRSAEPQETHSSCGVQGAHPRRWRSV
SRERWVETMVVADAKLIEYHGSDNVESYIFTIMNMVAGIFHDASIGNAIHVMLVRLILLQ
GEEKGLKIVHHADTTLTSFCAWQKNLNPQSDTHPAHHDVAVLVTRKDICAGMNQPCETLG
LSHLSGMCQPHRSCNINEDTGLPVAFTIAHEMGHSLGIHHDGHGNDCEPQGRHPFIMSRQ
LMYDSSPLTWSTCSKEYITRFLDRGWGFCLDDRPSKRDLTTPLARLGVRYTTEHQCQLQY
GPNATFCHEVDNMCQILWCSVNGTCRSKLDSPIDGTRCGPEKWCISGECVIVGKLPETVN
GGWGQWSTWSHCSRTCGTGVQSAERECSNPKPEFGGKYCTGERKRYRTCNTKRCQKNTPT
FREMLCSEFDTVPYHNELYQWIPVNNPSNPCELHCRPVMELFSERMLDAVTDGTPCFMNN
MSRNICVNGVCKAVGCDYGIDSNAVEDRCGVCLGDGKSCETVYKTFDGGESFGYVDVGVI
PEGARDILVKEVEEAGNFLALRNVTSEQYFLNGNFIIQWNGEYKAGGTTFYYERSGNMEN
LTAPGPTKRPVMLQLLFQEKNPGIKYEYTIKKTRETGNDLIEPLYRWRHGAWTDCSTTCG
LGGQQQPVRCFEVDVGVVDESLCDPARRPEDRHRKCKNMDCPARWWVGGWQQCTVTCGPQ
GVRQRTVLCVRTVSAEERVLHPVECKHLPEPKPVVPCNRDVPCGKDWAVSDWEECPITCG
GGVRSRTVTCALAPGKTCDVLSKPRSRSLCALQSCPNSSLRRRPGPAPKYRRIYPPKSHP
TPNPGAPWAPTTSIVATDAATADSPNAPFTVRKENQETTIAFTTTTMSLSTPTNPHNVDA
DFELNVVRINEDERVVPSKVNSAGNDRKATDVEKVDEREEGEDGSTPNVTNPPTMQTTKA
PTAAYPTPDTSTQTWAGSTHRYPSSNPHTTLRINPNSLQKLRVPLTTAMYRSVPPAASIR
PTQAPPSTRAWTLFPNVASSRSTVTIVKLKKPAVTPNKNNPSPRAKKPSSKGSHSKGQNQ
QAESAMSSSISDQSNLRAREPISMDVFWVVGNWSECSTTCGIGAIWRTVVCSSQKDEDCA
SVKRPEPARTCHLQPCAIWHSGSWSKCPDSCVVVARRYREVQCVDSQSKRPLRPFHCQAV
SSKPVSTLTCPHKPCMIWSTSPWGPCSGSCGEGVREKMVYCPEPLRCDATQRPNSTEACK
LKPCTHWTAEDWEECSVSCGGGQQHRGVNCVSEQDLAVMPNSLCETISKPDTLRKCNMQE
CKTNTGPVCKKNTISARFCDKLKLLGRCSLRSVQRQCCVTCGS
Download sequence
Identical sequences G3NKU5
ENSGACP00000005948 69293.ENSGACP00000005958 ENSGACP00000005958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]