SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005972 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005972
Domain Number 1 Region: 215-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005972   Gene: ENSGACG00000004530   Transcript: ENSGACT00000005989
Sequence length 458
Comment pep:novel group:BROADS1:groupVI:5386670:5395033:1 gene:ENSGACG00000004530 transcript:ENSGACT00000005989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLAAELLLLLGLVLLTLHITVLRGSPLPQGNQTLSLDQDAALTENNINAKSSSVQRSP
EDRRSGPEHRLARRPATLPWAQGSSVHRDGPGAFLLDLHNFPDLSKADINGQNPNIQVTI
EVVDGLEGHEPEKGLRKESKPNWASPNWRNWWPRSSSPSSPSTAHQTEENDRTYGSNGED
SNFLRPSADWDRRGGTGGGGKAQTEYDPDYMDGDGDWSNWTACSVTCGNGNQKRTRSCGY
ACTATESRTCDMPNCPGIEDAFKTAATEVSLLAGTDGFNATELFGVDTDSCERWMNCKSD
FLKKYMTKVANDLPGCPCSYPTEVAYSTADVRDEITRRDFRWKDASGPKEKLEIYKPTAR
YCIRSMLTLESTTLAAQHCCYNDNMKLITRGKGAGTPNLISTEFSADLHYKVDVLPWIIC
KGDWSRYHQARPPNNGRKCPDNPQDEDYYKQFEEAREF
Download sequence
Identical sequences G3NKV9
ENSGACP00000005972 ENSGACP00000005972 69293.ENSGACP00000005972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]