SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006082 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006082
Domain Number 1 Region: 97-163
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000162
Family Ovomucoid domain III-like 0.00035
Further Details:      
 
Domain Number 2 Region: 261-315
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000236
Family Ovomucoid domain III-like 0.0084
Further Details:      
 
Domain Number 3 Region: 190-238
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000061
Family Ovomucoid domain III-like 0.014
Further Details:      
 
Domain Number 4 Region: 24-67
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000412
Family TB module/8-cys domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006082   Gene: ENSGACG00000004583   Transcript: ENSGACT00000006099
Sequence length 345
Comment pep:novel group:BROADS1:groupXIII:1936787:1941260:1 gene:ENSGACG00000004583 transcript:ENSGACT00000006099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKHHLHPGFLLLFIWLCHLMEHQKVQAGNCWLQQGKNGRCQVLYMSGMSREECCRSGRL
GTSWTEEDVPNSTLFRWMIFNGGAPNCIPCKESCDNVDCGPGKRCKMNRRSKPRCVCAPD
CTNITWKGPVCGSDGKTYKDECALLKAKCKGHPDLDVQYQGKCKKTCRDVLCPGSSTCVV
DQTNNAYCVTCNRICPEVTSPEQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKCIK
AKSCEDIQCSAGKKCLWDARMSRGRCSMCGETCPESRTDEAVCASDNTTYPSECAMKQAA
CSLGALLEAKHLGSCNSITEDQEVDEDDEDSDYMAYVHISSILDG
Download sequence
Identical sequences G3NL69
ENSGACP00000006082 69293.ENSGACP00000006082 ENSGACP00000006082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]