SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006392 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006392
Domain Number 1 Region: 43-92
Classification Level Classification E-value
Superfamily GLA-domain 8.07e-21
Family GLA-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006392   Gene: ENSGACG00000004841   Transcript: ENSGACT00000006409
Sequence length 194
Comment pep:novel group:BROADS1:groupXI:428273:438362:-1 gene:ENSGACG00000004841 transcript:ENSGACT00000006409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSALWVALLSLLQLGHAAGDPVVVGQQDATSFLSRSLLYNSWDFELVATGNLERECL
EEVCSYEEAREVFEDDTKTEAFWTNYVNSQENSPRVDVSGLVAGIVAILVSAGIATVLGI
YCYKNKKKSVAGSARAPVRMAADGQPALETVPLAPLPALPSYNEALHRSGQHDAPPPPYS
GGAPSEPADPGDNA
Download sequence
Identical sequences G3NM29
ENSGACP00000006392 69293.ENSGACP00000006392 ENSGACP00000006392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]