SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006409 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006409
Domain Number 1 Region: 1171-1378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.65e-44
Family Laminin G-like module 0.00047
Further Details:      
 
Domain Number 2 Region: 1647-1856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-36
Family Laminin G-like module 0.000000418
Further Details:      
 
Domain Number 3 Region: 1455-1634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.59e-27
Family Laminin G-like module 0.00083
Further Details:      
 
Domain Number 4 Region: 1-71
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000693
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 5 Region: 526-576
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000693
Family Ovomucoid domain III-like 0.0035
Further Details:      
 
Domain Number 6 Region: 366-428
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000208
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 7 Region: 80-146
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000018
Family Ovomucoid domain III-like 0.004
Further Details:      
 
Domain Number 8 Region: 169-219
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000541
Family Ovomucoid domain III-like 0.0082
Further Details:      
 
Domain Number 9 Region: 721-789
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000208
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 10 Region: 968-1049
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000288
Family SEA domain 0.0036
Further Details:      
 
Domain Number 11 Region: 445-493
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000291
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 12 Region: 242-289
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000115
Family Ovomucoid domain III-like 0.0075
Further Details:      
 
Domain Number 13 Region: 620-663
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 14 Region: 1371-1407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000076
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006409
Domain Number - Region: 674-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 311-358
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.037
Family Ovomucoid domain III-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006409   Gene: ENSGACG00000004839   Transcript: ENSGACT00000006426
Sequence length 1878
Comment pep:novel group:BROADS1:groupXII:5132168:5211178:-1 gene:ENSGACG00000004839 transcript:ENSGACT00000006426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRGMLCGFGAVCQIDQADPVQSKCVCKRVDCPSLVAPVCGSDSSTYSNECELEKAQCNAQ
RRIKVLRQGPCSLKDPCTDVACSYGSTCIQSSDGLSAKCMCPLSCEGKREQTVCGSDGED
YRNECLLHRHACKNQKNIRVQYPGSCDPCKESENNLNTMCRVGALTRQTIVFRPPEMCPP
GNEPLCASDGQTYSSVCALEATALQKGVKLRKIHAGPCKRLERCQAACPFNGVCVVEQQS
ARCSCDPIECDGTYKPVCGKDGRTYTNDCARRAECLGRLLIAVKHPGPCVLKWSRRCSLE
GTGGAGGTLKNRVTGCNPGHHCQTDESPVCRRRNLFHGTRCERSRVSIVFRSRNRIKHHQ
IDEACANCSFGAICDAQSGQCVCASECVDSHQPVCGSDGSTYDSECELHVRSCKQQMELR
VVSQGECKTCGSTVCAWGAICVRSKCECAQCSGEGLAPVCGSDGVTYKNECELRTSSCVQ
KSRIDVAKPGSCDEDCGSGGSGSGAESCEQDRCRTFGGSWDEDAEDDRCVCDFSCQSVPL
NPVCGSDGKNYSNECHLKKARCEKQEHLMIQNQGPCAAISSTSPPATTPPQHCSQSVYGC
CHDNVTAALGVGLAGCPSTCQCNVHGSYKGTCDPSSGQCSCKPGVGGQKCDRCEPGFWNF
RGIVTENMSGCTPCNCDATGSVRDDCEQMSGLCSCKTGVKGMKCNVCPDGCDKGSEAPTS
CDKLTCSFGATCTEVSGQAHCECPPPDCDDKNKTQVCGSDGVTYADQCQLRTIACRVRGD
ITVQHFGRCTVFVEHQSHSSIPCFLPFPPPDIISEPADRPTPKPPGSILPKPGVRHAAST
DQRSAHSTTLMHNRTKPIQTIQTGHSSRRTPVRVASSSEGSGSGEPSGDDQTAGSGIPTE
ASGAEETVGSTLASTTAPTAEERSSCDNGEFGCCPDGKTPSSTPEGANCPSTMKFSGFLH
LDQVEGQEIFYTREMEDPKSELFGETARSIEGALNELFRKSAAHKDFMSVRVRNLAPSNS
ILAFVEAHFNPDTRLTVEDIEGALLKQLKASRESGIAVKKPEDENIRFTNYGKSQDCSLN
RTASQLHCSLLTGLSSVPLPPTTTRPPPTSMYITRRPPGTTRRPNSAVVTSTEPHPATTA
AHVRGRPSHKAAKPCSSHPCLHGGTCEDDGNDFSCQCPAGRGGSVCEKVIRYFIPSFGGQ
SYLAFPTMSAYHPVRIPMEFRASETPGVLLYNGQTGKKDFISLALVNGKVELRFNTGSGT
GTVASKVQIHQGRWHQLVLTRKRRSARLSVDNEPYIEGESPQGTDGLNLDTDLFIGGVPE
EMKQDVSERTAVGTGLVGCIRVLDVNNRKLNLQESGGDSMYGSGVGECGNNPCQPNPCKN
GAACLVKEAEMFHCKCSKGFWGPGCGVKLYMSPKVLCHAVAGCVISVTNTDRSLKDAPTI
PEFQSPVAEGRGPYMPLFNGDSYLELKGLHLYGQDLRQKVSMTVVLMANDSNGLIFYNGQ
KSDGRGDFISLSLNDGILEFRYDLGKGPATIRSLKRLQLNVWNTINLERSNRKGEITVNR
KDPVRGEAPENKKSRKNLHVDLNLKESLFVGGAPDYSRLARVAALTEGFKGTIQEIILMG
TPILREENALRSSSVAMFQDHPCSQEPCHNGGLCKPTLHTYECLCLNGFRGERCQNPVYE
KAAGEAEAIAFDGRTFIEYHNAVTKSPESLENPSDQSEKALLVNKFELSIRTETTQGLVL
WSGKGVERSDYIALAIVDGHVQMTYDLGSKPVVLRSSVRVDTNRWIRIKASRALRDGSLQ
VGNEAAVTGSSPLAATQLDTDGALWLGGLEELAVARRLPKAYSTSFVGCIKDVVVDGVEL
HLVEDALNSPQILHCSAA
Download sequence
Identical sequences G3NM46
ENSGACP00000006409 ENSGACP00000006409 69293.ENSGACP00000006409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]