SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006467 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000006467
Domain Number - Region: 344-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 778-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00195
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 590-719
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number - Region: 124-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Laminin-type module 0.044
Further Details:      
 
Domain Number - Region: 561-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Laminin-type module 0.036
Further Details:      
 
Domain Number - Region: 731-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0942
Family Laminin-type module 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006467   Gene: ENSGACG00000004885   Transcript: ENSGACT00000006484
Sequence length 1069
Comment pep:novel group:BROADS1:groupXIX:6480953:6523120:-1 gene:ENSGACG00000004885 transcript:ENSGACT00000006484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLNPDDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNWFKCTRHRISYKTAYRRGV
RTMYRRRSQCCPGYFESGDLCVPLCTEECVHGRCVSPDTCLCEPGWGGLDCSSGCESDYW
GPHCSNRCQCQNGAKCNPITGACVCTDGYQGWRCEEPCERGYYGKACQLPCQCLNGATCN
HETGECVCAPGYSGAFCGERCPSGSHGSQCEHRCPCQNGGMCHHITGDCSCPVGWTGSVC
AQPCPLGKYGINCSKDCSCRNGGLCDHVTGQCRCAAGFSGRRCQDDCPVGTFGPQCNQRC
ECQNGAKCHHINGACLCETGFKGPNCQERFCPPGLYGLICDKYCPCNTTNTVSCHPLSGE
CTCSVGWTGLYCNETCPPGYYGEGCMLPCSCTNGADCHPVTGTCTCAPGYMGEDCATVCP
PGLYGPSCMSTCSCHNHAACSPVEGSCICREGWQGTDCSILCSSGTWGPGCNHTCSCANG
AACDPMDGVCTCSPGWRAEHCDESCPDGTYGLDCRERCDCSHADGCDPVGGYCRCYPGWT
GIHCDNVCPQGFWGPNCSVSCSCQNGGSCSPEDGTCVCAPGYRGTSCKRTCSPGFYGHRC
SQSCPQCVHSTGPCHHVTGHCECLSGYSGSLCNQVCPSGRYGRVCAEICLCTNNGTCNPI
DGSCQCFPGWIGEDCSHACSSGHWGPDCLNSCNCHNGAQCSVHDGECRCSPGWTGLYCTQ
RCPSGFYGRDCSEVCRCQNGADCDHVTGQCACRTGFIGTSCEAECSAGAFGYGCQQLCEC
LNNATCDYVTGTCYCSPGYKGIRCDQAALMMEELNPYTKISPARGSERQSAGAVMGIIFL
LLIIMAMLSLFVWYRQRQRDKGHEIQPSVSYTQAMHITNTDYSLSDPSQGSSGPCFSNPS
YHTVAQCNVVSTISSNLDGTLTLKSSTLKSRNGAEWRAYCNLNDLDITFALILIRYAGGA
EKQWRGVAHLCYYCVPMLNCTELLRLYDLYIDHGNFVDYVKSSMCGKSSLNSENPYATIR
EPPGLAGKHTESSYVEMKSPSHREVPFGGTATLLGIVSRNVYDAGSCSL
Download sequence
Identical sequences G3NMA4
ENSGACP00000006467 ENSGACP00000006467 69293.ENSGACP00000006467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]