SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006481 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000006481
Domain Number - Region: 68-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0587
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006481   Gene: ENSGACG00000004910   Transcript: ENSGACT00000006498
Sequence length 105
Comment pep:novel group:BROADS1:groupXII:5436179:5445574:1 gene:ENSGACG00000004910 transcript:ENSGACT00000006498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLCSSLLCSTGQLAVGTCEIVMLNRDSSVPRRTIARQTARCACRRGQIAGTTRARPACVD
ARIVRSRQWCEMAPCLEGEVCSYLFNRSGWTCTRGSGRIKTVTVI
Download sequence
Identical sequences G3NMB8
69293.ENSGACP00000006481 ENSGACP00000006481 ENSGACP00000006481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]