SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006719 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006719
Domain Number 1 Region: 852-935
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-22
Family DEATH domain, DD 0.000034
Further Details:      
 
Domain Number 2 Region: 157-248
Classification Level Classification E-value
Superfamily Immunoglobulin 8.57e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 245-299
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000222
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 4 Region: 301-355
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 5 Region: 50-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000972
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006719   Gene: ENSGACG00000005079   Transcript: ENSGACT00000006737
Sequence length 941
Comment pep:novel group:BROADS1:groupVI:6064567:6076218:1 gene:ENSGACG00000005079 transcript:ENSGACT00000006737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVSYTHILPFGCLFISYLSNSWVTAKESSDYSEAEVLPDSFPSAPAEPLPEFLLEPEDAF
IVKNRPVQLRCRASPATQIYFKCNGEWVNQNDHVTRESLDQVTGLVVREVDISVSRTQVE
ELFGLEDYWCQCVAWSSAGTTKSNRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPE
GTPAAEVDWLKNEDVIDPSQDSNFLITIDHDLIVKQARLSDTANYTCVARNVVARRRSST
ATLIVYVSGGWSSWTEWSECNARCGRGWQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTL
CPVDGGWTDWAKWSACGTECTHWRSRECQAPPPRNGGKHCSGSMMESKNCTEGLCARNKK
ISIEHASHPLAPGTSVAVYAGLVGALLLCVILVLCVGVLAYRRRCRHLHGDITDSSSALT
AAFHPGNYKPPRQDNTHPLHPSAPPDLTATAGTFRGPLFSLKQGVNDSPHKIPMTTSPLL
DPLPSLKIKVYNGSTLSSLELPADMGLCDGEILSLKSVSTMGRERDYHSHTLPREPGLST
SATMGNLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWDNTTLLSEGSQTVLSSCG
SPGMLLNRPVVLTLPHCAQLDTPTPDWLTLKTQTHQGPWRESLDEIERGDLFVFLVTLNL
REEGCQVLIEQPGNSQFICIHDTPHALKVPLVCYKYPACVCPPLSFNVQLSSCLGICISA
IEEVLDLERSLGGVLLEDPKPLIFKDSYHNLRLSIHDIPHTHWRSKLLAKYQEIPFYHIW
SGSQRPLHCTFSLERGSLAVSQIACKICVRQVEGEGQIFQLHTDIQETLPPHSPLPSGGT
CLPSSQVGPFAFRLPDSIRQKICASLDAPSARGCDWRLLARSLGFDRYLNYFATKPSPTG
VLLDLWEACHQADADLVSLATALEEMGKSEVLVVMTTDGDC
Download sequence
Identical sequences G3NN06
ENSGACP00000006719 ENSGACP00000006719 69293.ENSGACP00000006719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]