SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006843 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006843
Domain Number 1 Region: 197-392
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.78e-63
Family Reprolysin-like 0.0000101
Further Details:      
 
Domain Number 2 Region: 411-485
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 8.51e-20
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006843   Gene: ENSGACG00000005114   Transcript: ENSGACT00000006860
Sequence length 658
Comment pep:novel group:BROADS1:groupXIII:2810816:2818678:1 gene:ENSGACG00000005114 transcript:ENSGACT00000006860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMWSQMNSLTISYLHSFPLESRGHDLEDVKDYEVVRPVRLHSVRRRHAEHLRPETVRYA
MTLGGRDIEMRLKRNHELLTKDYTETYYQADGTRVTAAPDDIDHCYYHGSIVNDSQSSVS
ISTCDGLRGYFRTSAQRYLIEPLSGGDGGDHAVMTFEEKNSPPAVCGVTNTSWSDDYEPP
TSQSRSKSRTISITQKQKYIELFIVADNRAYVKMERDQTRLRKRIFEIVNFINMAYKPLR
TFIALVGLEIWSERDLFTVTPPAGANLNAFMMWRNSELLKRKQHDNAQFISGIDFEGATV
GLAYIGTLCSGHSVGVIQDHNDRAIAVGATMAHEMGHNLGMDHDDSITCACSADSCIMAA
ALSWNIPRTFSSCSGNEYEKYLLGRNPECLLDKPDFSDLLPPSVCGNGFLEKGEQCDCGS
ETECTNLCCNATICTLKEGAQCAEGECCEDCKVSPRSTECRRKQDECDLAEYCDGQSPIC
PEDVFGVNGLPCGADLGYCFDGRCPQRVNQCGKMFGGDATEGESFCYNQNTRGTYFAFCK
RPEKETYIPCQKEDVLCGKLFCHGGNVSPNYGRMVTVRNCKGTFYDDPTKDYGQVDTGTK
CGDGKVCSQNECVQLETAYRNVNCSAKCPGHAVCNHRSECQCEPGWLPPQCDSQDAAF
Download sequence
Identical sequences G3NNC9
ENSGACP00000006843 ENSGACP00000006843 69293.ENSGACP00000006843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]