SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006994 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006994
Domain Number 1 Region: 1430-1655
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.06e-81
Family Fibrinogen C-terminal domain-like 0.00000245
Further Details:      
 
Domain Number 2 Region: 900-1076
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-21
Family Fibronectin type III 0.00042
Further Details:      
 
Domain Number 3 Region: 1169-1258
Classification Level Classification E-value
Superfamily Fibronectin type III 1.35e-19
Family Fibronectin type III 0.0000844
Further Details:      
 
Domain Number 4 Region: 1261-1425
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-19
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 5 Region: 722-886
Classification Level Classification E-value
Superfamily Fibronectin type III 1.58e-16
Family Fibronectin type III 0.0000787
Further Details:      
 
Domain Number 6 Region: 630-717
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000155
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 7 Region: 1082-1169
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000182
Family Fibronectin type III 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006994
Domain Number - Region: 358-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000491
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 545-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000949
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 420-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 513-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 451-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00235
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 328-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00274
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 390-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00302
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 235-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 204-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00402
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 297-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00542
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 483-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00949
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 266-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006994   Gene: ENSGACG00000005274   Transcript: ENSGACT00000007012
Sequence length 1662
Comment pep:novel group:BROADS1:groupXIII:3065575:3105091:1 gene:ENSGACG00000005274 transcript:ENSGACT00000007012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVKGLLFGCVTVALLLELSTAGLLKKVIRHRRDALAPTKTQENLTLPHPDQPVVFNHVY
NINVPTTSLCSVDLDSPGDGDLKHKSAPLEMQNAEHMEHTVDGDNQIVFTHRINIPKQAC
GCDNQLPDIKDILNRLEMLESELSSLRDQCSSGTVCCGAQVTGEVSTKPFCNGHGNWSTD
TCSCLCEPGWKGYNCTEPECPNDCQDQGRCVDGKCECFEGFGGDDCSIELCLLDCGDYGH
CVDGSCLCEDGFIGEACDQTNCLNNCLGRGRCVDDECVCDEPWTGFDCSELICPNDCYDR
GRCVNGTCYCDEGYAGEDCGELTCPGNCNNRGMCVNGQCECQTGYSGEDCSKLTCPKNCN
ERGHCFNGKCICDPGFEGEDCSVLSCPDNCSNRGQCIDGECVCDVGYQGEDCGELSCPNN
CQDRGRCVNGQCACDAGFAGEDCSVKTCPKACMGHGECVDGNCVCFVGFAGEDCGELTCP
NDCLDRGDCVSGQCVCHKGFTGEDCGEKTCPKNCLDRGYCVDGDCVCYEGFTGPDCSIKT
CPNDCQDQGRCESGVCVCNEGFIGEDCSVVEHLEQKSSDRPFLPEHLRIGSGTEPTNLLK
SEKNNHNASKHMNHKCNFLENTDFGRLSAVSPPKDLTVVEVTPEVVDLSWENEMRVTEYL
ITYVPTAQGGLELDARVPGDQKMTTIRELEPGVEYLISVYALLNNKKSLPVSARVSTHLP
EPEGLKFKSVRETSVQVQWDPLDIKFDGWNLIFRNTKEEDGEILNSLGRPETTFEQSGLG
PGQEYEVKLEVVKNNKRGPPASQNVVTMIDAPSQVDVRDVTDTTALATWSQPVAEVDGVS
VSYGPSSNPADRTVVKLSSTETQYHLGGLTPDTQYEVSLLARRGERTSIPVYESFLTDLD
APRDLQTVELTDETITLEWKNSRAPVENYRIKYGPLSGGEHGELLFPPGPKDTTQAKITG
LRPGTEYGMGVTAVTDERESLPATTNAETALDAPKDLAVAEVTETTMMLEWKRPLAKLDF
FKLVYVSAEGHKAEDVVPSSSESYVLRGLAPGTLYTVSITAERGRRTSAPTTISAPTEEE
KPEVTNVTVSDVSWDSFLLSWSAEDGAFEAFLIEVTDAETGAEWQNHTAPADARSLLISG
LSSTTWYRANLYAVYRGAVLNPVFADTITDLGSPKGIRFSDVTDTSATVHWVPPKARLDS
NRVTYVPAHGGNAKTLTVSGSESQTVLPNLTPGVTYEVTVVAVKGQRESKPGSDSVTTAL
DKPRGLNAINITDTEALLLWQPAIATVDGYVITYSADSVAPVMERVSGNVVDFDMSSLTP
ATHYTVKVYAVRDLAKSAATSTDFTTDVDAPQDLAASNIQTENAMLSWKPPRADITGYIL
SFEAADGTIREVVLSPTAVSYNMAPLSASTEYTVKLQAIAGPKRSRVVTTVFTTTGVLYR
FPKDCSQALLNGDTTSDLYTIYLGGDESQPIQVYCDMSTDGGGWIVFLRRQSGRLEFFRN
WKNYTGGFGDMNDEFWLGLSNMHKITTGGQYELRVDLRDKGETAYAQYDKFSVSEPRTRY
KVHVGGYSGTAGDSMTYHHGRPFSTYDHDNDIAVTNCAQSYKGAFWYKNCHRVNLMGRYG
DNSHSKGVNWFHWKGHEHSIEFAEMKIRPSNFRNLEGRRKRS
Download sequence
Identical sequences G3NNT0
ENSGACP00000006994 ENSGACP00000006994 69293.ENSGACP00000006994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]