SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007006 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007006
Domain Number 1 Region: 202-229,262-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-40
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 857-1038
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-36
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 459-653
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.16e-36
Family Laminin G-like module 0.0008
Further Details:      
 
Domain Number 4 Region: 664-854
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.76e-31
Family Laminin G-like module 0.0087
Further Details:      
 
Domain Number 5 Region: 15-177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.37e-30
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 1085-1220,1253-1290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-28
Family Laminin G-like module 0.00000258
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007006
Domain Number - Region: 1059-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00396
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007006   Gene: ENSGACG00000005280   Transcript: ENSGACT00000007024
Sequence length 1593
Comment pep:novel group:BROADS1:groupXVIII:2211718:2416099:-1 gene:ENSGACG00000005280 transcript:ENSGACT00000007024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPISLAGFFFSLLGTMLGLSVGLEFTGAGGQWARYLRWDASSRSDLTFQFKTSQSEGLL
LYFDDGGYCDFLLLAVSDGKLQLRVSIDCAETTITSDKVVNDGRRHFAAINRHNLRTGLA
VDGQTKTEEVRPQRRFMKIVSDLFLGGLPVDIRTSAITLPSVRELPPFKGIITDLSYGSK
LPTLINSQKVRLEMMGLCTENPCENGGICSLADGEPYCDCSRSGYVGQYCTEEVTANTRL
SLLLLNVYDLNQKGPCLIHASMSPSAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSF
KTWQRNGLLLHTGKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDIKV
TRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLRE
VVYKNNDIRLELSRLARIVDPKMKLQGDVVFKCENVPTLDPINFETPDSYLALPKWNTKR
VGSISFDFRTSEPNGLILFTHGKPQDRRDPKGQKNNKVDFFAVELLDGGLYLLLDMGSGT
IKVKATQAKVNDGVWHHVDIQRDGRSGIISVNSRRSPFTASGENEILDLEGNLYLGGLPD
SRAGLVLPTELWTAMLNYGYVGCVRDLFIDGRSKDIRQIAQSQNATGIKSSCSKVTGKQC
DSNPCKNNGACKEGWNRFVCDCTGTGFWDSTCEREASILSYDGSMYMKVVIPNVMHTEAE
DVSLRFMSQRAFGLLMAATSRESADTLRLELDSGRVKLTVNLDCVRINCNTSKGPEVLYA
GQKLNDNEWHSVRVVRRGKIFKITVDDDMAEGQMAGDHTRLEFNNVETGILTERRFVSSA
PSSFIGHLQSLKFNGMQYIDMCKNGDIDFCELNARFGMRFIIADPVTFKTKGSYLGLATL
QAYTTMHLFFQFKTTSPDGFIIFNSGDGNDFIAVELVKGFIHYVFDLGNGPSLLKGNSDN
PLNDNQWHNVVITRDASNTHTLKVDAKSVTQNVNGAKNLDLKGDLFVGGLGPNMYQNLPK
LVVSREGFQGCLASVDLNGRLPDLINDALFRSGQIERGCEGPSTTCQEDSCANMGVCIQQ
WENFTCDCSMTSYSGTHCSDPGTTYIFGKGGGLITYTWPNNERPSTRTDRLAVGFSTTIK
DGILVRIDSAPRLGDYIMLHIEQGKASVTFNIGTVDISVKETATAINDGKYHLVRFTRNG
GNATLQVDNWPVNEHFPTGNSDIERYQMANKKIPFKYTRPVEDWLQEKGRQLTIFNTQAT
ISIGGNDRKRPYQGQLSGLYYNGLKVLNMAAEGHVNIRVNGSVRLVGDVPVSRGAARTTT
SAPPEMSTTFIETTTTLSTTTTRKQRSPPTIQQTTDDIVSSAECSSDDEDLEECDSGHVT
DKILTTSAYEGSYKVLAPKWEAKDLRPSKASEAGRTTPSSPLPDLRGTPAVPSDKPPKLP
AGKMNNREVKPPQPDIVLLPLPTTFDLDGTKPRGPFITSPMLRTVPAPLPTVPGVVRRVP
PGASEVIRESSSTTGMVVGIVSAAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQ
TNGAVVKEKTPSGSAKGSASTKRPKDKDKEYYV
Download sequence
Identical sequences G3NNU2
ENSGACP00000007006 ENSGACP00000007006 69293.ENSGACP00000007006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]