SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007034 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007034
Domain Number 1 Region: 1142-1228
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-19
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 740-796
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 3 Region: 1054-1139
Classification Level Classification E-value
Superfamily Immunoglobulin 6.85e-16
Family I set domains 0.05
Further Details:      
 
Domain Number 4 Region: 913-994
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000197
Family I set domains 0.023
Further Details:      
 
Domain Number 5 Region: 2-53
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000366
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 337-395
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000837
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 7 Region: 276-332
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 394-451
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 9 Region: 457-510
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007034   Gene: ENSGACG00000005303   Transcript: ENSGACT00000007052
Sequence length 1285
Comment pep:novel group:BROADS1:groupXV:1547817:1561936:-1 gene:ENSGACG00000005303 transcript:ENSGACT00000007052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHWDSWGPFGECSRSCGSGVTMRTRRCITLRTDGGHNCVGPDKSYRTCNIQDCPEGSKDF
REEQCSQFDGTNFQGKLYKWLPYYGGKKQPELHPQRENFFYRHRSAVVDGTSCHPGRRDV
CVGGVCKRLGCDNTLESARQEDPCLQCGGNGQSCHRVKNSFSVRGLPTGYNQMFIIPVGA
TTISIRETVATRNYLAIKNLRGEYYLNGHWVIEFSRSTPIAGTVLYYQRGAEGDNVPETV
IGRGPTTEPLVVELISQEPNQGVEYEFYLPNGRSRQGYYWSFGSWTSCSAECDSGYQSRS
VFCTIDNESYPDYLCASLPMPQTNRTCNAHACPHVRSWETGEWNACSITCGGGSQVRSVQ
CVSHDAAGPRVVEDAVCAAYSEAPPTLQTCNMQECAEYQVTGWSACSVTCGPGEQTREVA
CVGSAGTLLEEPSCGALLRPAAVRPCETASCLRQIGWHVGDWGLCSRSCGSGSRERRVIC
ADRERRLYPVARCDAEPKPSTVELCNSQSCYRPQEVPSVQDTRGHDDRAQTVFQPHVPDQ
ATGWTRSLIPLHPILSADVTPPPHHQLSSLCRAYVLFIAAETEPRRANAVHAAALHCSQS
YYGCCPDGRTSAGGPRGLGCPRAPAPVQPHCVQTSYGCCQDGVTAAWGPDKEGCVEHAAP
APTVSKTPFLLHVRAAADESQEAPFLSLIGDVALPQAAPSLPTENAAGCRLTTFGCCYDR
TTPAGGPSGEGCPDPPNHVERSICSLPRAAGSCSAWVPRYHHDAAAGECVHFWYGGCHGN
SNNFMTRAECQRGCRGPARSQRGPEPAPPAAEPTPRREPGAGRAASGGSAAGGSRSAGRI
FTVQGGSTGATGRRAKSPADHAHRARVLPARRPRGEVRPRKSPGSAGVKKKARPPPAPII
LTLGEVTIGKSDPSTVEALVGQTAVLACRVSPPPSSSVTVEWRRDGVPLSTRRHHRQPNG
SLLVGPLSQLDSGWFLCVATRERERDHRYVHLSVSDHLMYLIKPQEIHFKRASRQWDPSR
FPPYCPQTVRSLGKDHFSSIHTKVCLPLNIERSGPSSLETRAGQTATLSCTVVPPSALQS
VSVQWSKDGHSLSGSRFAQHSDGALTIGSLKSSDSGVYTCTASSQQQLEQRQLQLRVQAD
LKITTAPNNIQVPEGTTALLPCVVSGDNVNIGWSRNGIPVRPDGRNIQTSPDGSLILNDV
KPQDEGTYTCNAYTGIYSVSATADVRVIKAAEGDDVPADCVDQPELANCELIVYARLCSN
SYYSSFCCASCTRQAQRKRRLARLG
Download sequence
Identical sequences G3NNX0
ENSGACP00000007034 ENSGACP00000007034 69293.ENSGACP00000007034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]