SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007054 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007054
Domain Number 1 Region: 83-140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000556
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 226-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000395
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 3 Region: 141-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000975
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007054   Gene: ENSGACG00000005336   Transcript: ENSGACT00000007072
Sequence length 433
Comment pep:novel group:BROADS1:groupVI:6296011:6304236:-1 gene:ENSGACG00000005336 transcript:ENSGACT00000007072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSFRRRCLLLLCLTAVHSDAAVQTCMDKHQVVGVLRQMEKFLKGQELRFTEGLRIMKS
KLATLQNSVSKLPQADQSAAPTTCPTLEAPAHGTKFGSKYFLGHEVHFTCFPGYHLVGSA
TRVCRDNGTWTGISAVCNATDVSECASNPCQNGGTCVEGVNQYKCTCPQNWSGSHCQHQT
QTRSSREDVPSGAVFAWNISWCSSGRACQSLCFSWHLSRLVSISFLTDVNECEVYRLDRG
GKLCAHECVNVPGSYHCACPSGYKLLPDGRSCEDVDECLTQQHNCSRGTTCINTGGDFLC
VNPECPASHGNISYVRTSPFQCERNPCPMDSRSCHLAPKTVSFHYLSLTSNLKTPATLFR
MADSLRFGIVGGNTRGIFVMQRSDRQTGELILVQQLRGPQEISVDVDMSEYSERTFQAKH
VARVNVLVSPYGF
Download sequence
Identical sequences G3NNZ0
ENSGACP00000007054 ENSGACP00000007054 69293.ENSGACP00000007054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]