SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007135 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007135
Domain Number 1 Region: 823-900
Classification Level Classification E-value
Superfamily DEATH domain 2.52e-18
Family DEATH domain, DD 0.0000748
Further Details:      
 
Domain Number 2 Region: 219-270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.46e-16
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 129-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000342
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 273-327
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.00083
Further Details:      
 
Domain Number 5 Region: 22-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000356
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007135   Gene: ENSGACG00000005395   Transcript: ENSGACT00000007153
Sequence length 925
Comment pep:novel group:BROADS1:groupXIII:3541942:3609276:1 gene:ENSGACG00000005395 transcript:ENSGACT00000007153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSAGAAGDAQPDALPSVQGTLPHFIQEPEDAYIVKSNPIKLRCRAAPALQIFFKCNGEWV
HQNEHFSQEYKDLNTGLKVREVMINVSRQQVEDFHGPEDYWCLCVAWSHLGTSKSRKATA
RIAYLRKNFEQDPQGKEVPINGMIVLHCRPPEGVPVAEVEWLKNEELLSSLTDDNIDTRA
DHNLIIHEARLSDSANYTCLASNIVAKRRSATATVIVFVNGGWSLWTEWSPCNVPCGRGV
QRRSRTCTNPAPLNGGAFCEGMSVQKITCNALCPIDGGWDEWTEWTVCSSQCEKLRGREC
SAPAPRHRGKMCEGNSEATENCTDGLCTQNRKLLHDVKPQTWSRQWYGRLHDVALYSGLG
AGVIAVAILVAIMLYRRNHSEYGVYVIDSSRAHRGFTVFQTENSRQDFSLFSPFSVVELT
EKQKASDVIFKTNDLKYSIVQKVLSIYVNISSSSIKTSESKIRVELRVVSQLESGGLGKE
TINTFKPLESKKKILKQNEKPYQRDFSSSKVHTILPAVGVVAVDAFVCVFPGVSLLVPQG
AVAENTSWEMHMVINQGESSVQTLEGCEILLGPEVTYGPPVLDLSTPVAMSIAHCAEVDA
ENWNIQLKRKTQDSKWEEVMSVEEECTSCYCLMDSTSCHLLVGQPGSYALVGEPLTQAAV
KRLKLAVFGSMEAGSMSYGLRVYCVDDTPHAFQQGVVAAEKSRGGQLLEEPKMLPFRANT
FSLQVSIQDVPQFLWSIKPFTTCQEFSFPQVWCSNQQPLHCAFSLERFSPATAQLSCKIS
VRQVKGHEQILQVYTAVAEAEKESVPFFMQADCTITSQTGPKAFKIPSSIRQRICATFDT
ANAKGKDWQLLAQKLHLDRNLAYFAKQRSPSAVILNLWEARHQDTADLDSLASALEEIGK
IHSKSSPKDQDQDEARPNFGHAEAG
Download sequence
Identical sequences G3NP71
ENSGACP00000007135 69293.ENSGACP00000007135 ENSGACP00000007135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]