SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007144 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007144
Domain Number 1 Region: 204-245
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000262
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007144   Gene: ENSGACG00000005405   Transcript: ENSGACT00000007162
Sequence length 441
Comment pep:novel group:BROADS1:groupXVIII:2520157:2528811:1 gene:ENSGACG00000005405 transcript:ENSGACT00000007162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAAARCPLLVLVLSVLLVSPGTSFPTGHKNGVHMQNQVRSLLSEPHSHQRRWSHPQHHSV
GVLPQPEPEEETKPFILDLKNFPELANADIHPQNPNIQVTIEVVDDPQMEVEIDVAKEKD
WLPSSSSSPSSTVDWLGGKTLFWPLFWSYTDSESSEDSSNRSGVGETGEEEEEEDYSLDY
GSEEPLPSGVGGDWDTRWNEEKETDEWTPWSPCSVTCGNGEKKRTKSCGYSCTLTEASKC
DLEPCPGEVNTVVEPFPFEMENGTQPFGTDVDSCEKWLNCKSEFLQRYLHQVLSEMPSCP
CSYPSEAAYAVVSVHDESRGRPFSWRDASGPKERLDIYKPSARSCIRSALSSDSSTLAAQ
QCCYGDRGRLITRGKGAGTPNLISVEFSPELHFKVDVLPWILCKGDWSRFHAVRPPNNGL
SCPENPHEDVFMNELEEAREY
Download sequence
Identical sequences G3NP80
ENSGACP00000007144 69293.ENSGACP00000007144 ENSGACP00000007144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]