SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007152 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007152
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000298
Family Growth factor receptor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 103-155
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007152   Gene: ENSGACG00000005408   Transcript: ENSGACT00000007170
Sequence length 168
Comment pep:novel group:BROADS1:groupXX:3897398:3906081:1 gene:ENSGACG00000005408 transcript:ENSGACT00000007170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCSVCSRDNGCVNCQPKLFLFLRRERMRQYGECLLDCPAGYYGMRTLEINMCSRCRIENC
ESCFSKDFCTKCKSGFYLHKGRCFDKCPEGFAPLEDTMECGEGCEVGQWSEWGACNRRNK
TCGYKWGLETRTRHIVKKPPKDTIPCPTIAESRMCKMAIRHCRRGKDV
Download sequence
Identical sequences G3NP88
69293.ENSGACP00000007152 ENSGACP00000007152 ENSGACP00000007152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]