SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007378 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007378
Domain Number 1 Region: 475-681
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-37
Family Laminin G-like module 0.00098
Further Details:      
 
Domain Number 2 Region: 693-884
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-37
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 3 Region: 282-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.45e-33
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 4 Region: 29-193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-30
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 5 Region: 1101-1241,1270-1314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.63e-29
Family Laminin G-like module 0.00000192
Further Details:      
 
Domain Number 6 Region: 888-1068
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.06e-28
Family Laminin G-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007378
Domain Number - Region: 205-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007378   Gene: ENSGACG00000005573   Transcript: ENSGACT00000007397
Sequence length 1511
Comment pep:novel group:BROADS1:groupVI:6583535:6775951:-1 gene:ENSGACG00000005573 transcript:ENSGACT00000007397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YHTMVLQKPHGAHIVWVGLLLCCFAEIGTCLEFTGAEGQWARFPVWNACCESEMSFSMKT
KSSNGLLVYFDDEGFCDFLELLILNGKLSLRFSIFCAEPATVVSDTAVNDSQWHAVTIRR
NFKNTTLKVDNEKKWVEVKSKRRDMTVFSHLFVGGIPPELRSVALRLTSDAVKDQLPFTG
WITDIKVNNTEPVMIDGEGVLEDLCGSANMCLNGGVCSIINNEPTCNCSRTGFQGKDCSE
EDNYTEGPAHLMMGDQESSKEMQHVKGMSSYFSGRVSAGKEEYVATFKGSEFFCYDLSLN
PIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVN
GKFNDNDWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDD
FFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSSMAKLGDPKMKVHGTVAFK
CENVATLDPITFETPQSFIILNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSK
NPQTLKVDFFAIEMLDGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISI
NTLRTAYTAPGESEILDLDDNLYLGGLPENKLGLVFPTEVWTALLNYGYVGCIRDLFIDG
QSKDVRRLAEVQKAAGVKPSCSKEPPKQCLSNPCQNNGVCREGWNRYVCDCSGTGYLGRS
CEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLEL
ESGRVRLTVNLDCIRINCSSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLQSV
EGQMAGDHTQLEFHNIETGIVTEKRFMSMVPSNFIGHIQSLSFNGMAYIDLCKNGDIDYC
ELNAMIGFKNIIADPVTFKSRASYVTLTTLQAYYSMHLFFQFKTTSSDGLILFNSGDGND
FIVERCLINYLHYVSDLGNGAHLIKGNSNKPLNDNHWHNVIISRDTNNLHTVKIDTKITT
QTTTGAKNLDLKGNLYIGGVAKEMFKELPKLVHAKEGFQGCLASVDLNGRLPDLMSDAVD
CVGQIERGCEGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRD
GGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSSSGLGDFLKLHIEKGNIAVVF
NVGTDDINIEETSKFVNDGKYHIVKFTRSGGNATLQVDDLPVIERYPTGNNDNERLAIAR
QRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWERDRSGSFQGQLSGLYYNGLKVFN
MAAEGDPNIRIQGSVRLVGESPSSITPQSSTTANRSETSTSIMEITTTTASSRRAKQTTP
REPQQTTDDLLVASAECPSDDEDIDPCEPSSGGLANPTGGYPGTPEVFRESSSTTGMVVG
IVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGTVVKEKPVNTAKTSSK
SKKNKDKEYYV
Download sequence
Identical sequences G3NPW3
ENSGACP00000007378 69293.ENSGACP00000007378 ENSGACP00000007378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]