SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007626 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007626
Domain Number 1 Region: 961-1174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-101
Family Thrombospondin C-terminal domain 0.00000000607
Further Details:      
 
Domain Number 2 Region: 30-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-39
Family Laminin G-like module 0.0000198
Further Details:      
 
Domain Number 3 Region: 838-959
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.1e-35
Family TSP type-3 repeat 0.000000602
Further Details:      
 
Domain Number 4 Region: 494-552
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.92e-16
Family TSP-1 type 1 repeat 0.0000855
Further Details:      
 
Domain Number 5 Region: 769-842
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000248
Family TSP type-3 repeat 0.00031
Further Details:      
 
Domain Number 6 Region: 440-495
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000432
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 7 Region: 696-781
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000915
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 8 Region: 323-381
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000105
Family VWC domain 0.0025
Further Details:      
 
Domain Number 9 Region: 386-429
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007626
Domain Number - Region: 554-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000781
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007626   Gene: ENSGACG00000005771   Transcript: ENSGACT00000007645
Sequence length 1176
Comment pep:novel group:BROADS1:groupVI:6955838:6969318:1 gene:ENSGACG00000005771 transcript:ENSGACT00000007645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILRRSLFLLLLSSTFLHALPQDDEQEDETSFDLFEISHITRKTLGAKQFRGQNSDAPAY
RFIRFDHLPPVSPPILKQILRQIQNNEGFVFVASMRQDRTSRGTLIGLEAPDGRRQFEIV
SNGRANTLDLVYWVDGSQNVVSFEEVDLSDSQWKNITLHVHGENANLFVGCSLIDSFILD
EPFYEHLKAEGNRMYVAKGSTRENHFRGLLQNVRFVFDTPVEDVLLSRDCEVPKQEYVNI
VSESTEIMDVSPSITTNIIGQQTDNPAADMCERSCEELSTMFQELKGLRVVVSNLIDGLQ
KVTEENTLMKEALGRMKNTKEKNMCWQDGRLFDDKEDWVVDSCTKCTCQESKIVCHQITC
PPVACAIPSFIDGECCPVCMPTDSEDGWSPWSEWTECTVTCGTGTQQRGRSCDATSNPCT
GPSIQTRKCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQLGGKDC
EGSGRETQRCTAKPCPVDGSWGPWSPWATCSATCGGGVKSRARVCNSPQPQYGGKNCNGE
AKDSDVCNIKDCPLDGCLSNPCFGGVECNSSPDGSWECGPCPTGFRGNGTNCEDINECDM
VSDVCYKVSGMQRCINTDPGFHCLPCPKRYKGTQPFAVGVEAAKKNKQVCEPENPCKDNT
HNCHKYAECIYISHFSDPMYKCECRTGYAGDGFFCGEDSDLDGWPNQNLVCGANATYHCK
KDNCPSLPNSGQEDFDKDGQGDACDKDDDSDGILDERDNCPLLYNPRQFDFDKDEVGDRC
DNCPYEHNPAQIDTDHNGEGDACAVDIDGDDIMNESDNCPYVYNTDQKDTDMDGVGDHCD
NCPLLHNPDQTDVDNDLVGDQCDNNQDIDEDGHQNNQDNCPYVANANQADHDKDGKGDAC
DYDDDDDGIPDDKDNCRLTPNADQIDSDADGRGDACKDDFDNDNIPDILDVCPENDAISV
TDFRKFQMVHLDPKGTTQIDPNWVVRHQGKELVQTANSDPGIAVGFDEFSAVDFSGTMYV
NTDRDDDYAGFVFGYQSSGRFYVVMWKQITQTYWEDKPSKAFGISGVSLKVVNSTTGSGE
NLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKLIMAD
SGPIYDKTFAGGRLGLFVFSQELVFFSDLKYECRAK
Download sequence
Identical sequences G3NQL0
ENSGACP00000007626 69293.ENSGACP00000007626 ENSGACP00000007626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]