SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007687 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007687
Domain Number 1 Region: 1236-1301
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-20
Family TB module/8-cys domain 0.0000617
Further Details:      
 
Domain Number 2 Region: 519-583
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.81e-19
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 3 Region: 931-1056
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 1413-1473
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000209
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 5 Region: 678-808
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000033
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 398-465
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000719
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 7 Region: 807-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000675
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 8 Region: 464-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000718
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 9 Region: 1552-1641
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000105
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 1045-1092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000491
Family EGF-type module 0.006
Further Details:      
 
Domain Number 11 Region: 1356-1400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1059-1178
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000235
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1325-1370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 47-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000684
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007687
Domain Number - Region: 250-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000986
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007687   Gene: ENSGACG00000005814   Transcript: ENSGACT00000007706
Sequence length 1643
Comment pep:novel group:BROADS1:groupXV:2022468:2079686:1 gene:ENSGACG00000005814 transcript:ENSGACT00000007706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARRQTPERPAAPNRGEPPAGQPNVCGGQQCCSGWAVAPGTNRCIKPDCQPPCQNRGSCSR
PQTCVCRSGFQGPRCEEVAPEQVYDQPRRRPSVQTPRPATTRQPVSHRAAVAGRKYCTKR
GPSIPGCTPAPEVRQIQRWPGEQQTGTSRTVKRYPSSSGPITSNAIPYNGNGYANGHGGE
RGSGHGHPTPPPDAGANLTSHLDRIKIVFTPMLCRRVCSGGRCHNSCEKGDMTTVYSENS
KDQGYRLFFCQIPCLNGGRCIGRNLCWCPSNSTGKFCHLPAPPPARPSPVDHKDAGHQGP
KAALHSMYTLPLSNQQVSLSPSLVNVHIQHPQGAEVEVHQVARVLPGSRPAAADGAHSVQ
QRSQPANGPEPTGGHGGWHPHAGGNRNHGATTHNHQNGPVGRCFQETVDGQCGEPLPGLT
KQDDCCGSVGASWGLNKCQRCPTKPAYAVIANGRVECPQGFKRMNLTHCQDINECLLPGL
CKNAECLNTKGSYRCTCKPGFLLDADRSHCVSDKAVSDQTALCYRSASAGACSLPLAQRL
TKQICCCSRVGKAWGPGCDRCPLHGSEHFKEICPAGHGYTYSRSDVQISVRQLEEEDLQS
TGESREEQSPTFPQPPPSQPWLPRPSRPHHSGRPETPQAPREPPTPQQPLRPAQPSSETP
RQPEDSDSEDTTRTHPDAGIDRCATAPAVCGPGKCIPVQTGYTCRCEPGFKLGALQTNCI
DVDECDGDPCEGKGRCVNSYGSYTCQCHSGYSQVITQNSKFCQDINECSMPNKCQNGECV
NTEGSYTCECDGGYAKSGRGQCEDVDECRDPGSCPNGLCINTPGSFQCEACGPGFRPVWG
RCVDVNECLNQTACGRGRCVNTDGSFRCNCFPGYELAPDNVCQDVDECQSVSTCANGICL
NSEGSYTCENCPTGYSVTSDGELCQADIDECRGPDVCPMAVCTNTAGSFACMACDPGFTV
APNGLSCEDVNECEDPGLCVGGRCANTVGSYDCLCPAGLEMVDGTSCRDINECLTATGIC
GEADCLNTKGSYTCICPDGYATKDGGTGCQDVDECSGGNVCIRGECLNTDGSFMCLCEAG
FKFNDDTADCEDQNECKDFGSSVCGTWRCENTIGSYRCFMGCQAGLQGEDATDCADIDEC
ANETICGNYGFCENTDGSFRCQCYQGYANPPGDTGTNCSSINNDFRKDKCGDTRGVNFFW
GILCVCVFLKPTTNESPHVGPTPGALLPHSAPRGEERKECYYNLNDANFCDNVVSRNATK
QECCCTVGAGWGDDCEIHACPLPGRDDYDQLCPHGSGLLPRPVPATQNPGDQRAYIDANE
CEMFGSDICKNGQCSNLFSTYTCYCRSGFYYDNVRLECVDYDECGFGDACEDGVCVNTAG
SFNCFCSPPSVLDSTRRRCIGLNATEETLEPDHDVHMDVCWQRLEGDNICSQPLQGRRST
YTECCCLWGVAWSEQCAFCPAKDSGARRTPCGRARLRRPAGRGAMDPFSPPYGLGPPTAA
VPVSLLGAGEGPPAPGEFPPRGGKPSPILNGLPASGQSRVFCVQSERYGGFEGLRAEECG
ILNGCENGRCVRVREGYTCDCFDGYELDLNKMACIDINECEDISDNVPLCQNGRCTNSEG
SYKCACLPGFVASAEPHRCIPDV
Download sequence
Identical sequences G3NQS1
ENSGACP00000007687 69293.ENSGACP00000007687 ENSGACP00000007687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]