SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007790 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007790
Domain Number 1 Region: 427-563
Classification Level Classification E-value
Superfamily TIMP-like 3.92e-27
Family Netrin-like domain (NTR/C345C module) 0.021
Further Details:      
 
Domain Number 2 Region: 201-296
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 378-434
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 4 Region: 112-161
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000013
Family Ovomucoid domain III-like 0.025
Further Details:      
 
Domain Number 5 Region: 30-81
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000131
Family Elafin-like 0.002
Further Details:      
 
Domain Number 6 Region: 313-375
Classification Level Classification E-value
Superfamily BPTI-like 0.000027
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007790   Gene: ENSGACG00000005897   Transcript: ENSGACT00000007809
Sequence length 572
Comment pep:novel group:BROADS1:groupV:7785564:7787476:-1 gene:ENSGACG00000005897 transcript:ENSGACT00000007809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWMLFPRWIWFLACVLVWMEHQDGVLPEVTYSHPGICPNDMNPNLWVDAMSTCTRECES
DKECESFEKCCQNVCGRSCVAARFLDGNKAPMGIPKEATCTSFTCTQQGSECDIWDGQPV
CKCRDRCEREPHFTCASDGMTYYNKCYMDAEACSKGIVLAVVTCRFHLTWPNASPPQVTT
LRPTTAPLQATMPLPTEPVTPALVSSPVHQIVAVGDTASFLCEVTGRPRPDITWEKQQPE
GLERVAMRPNHVRGNMVVTNIGQLVIYNAKPHDAGVYTCTARNPSGSVQADHPLTVLPTE
PHKTLAPWNMTRCLPEECLKPPDSAEDCRSEMDKVSWYYEPKTNSCFSFTQCHIDKQKPW
KVFETYQGCMQCCGPEISGPCGLPSLQGPCKAYEPRWAYSSTLQQCQPFIYGGCDGNDNN
FESKDVCEETCPYSKIHHCKACKVRGKMVMSFCQSDFVVLGRMTELTEEKDSGHALVTVE
EILKDQKMGLRFFGKEPLEVTFFNIDWNCPCPNITAAAGEGQVIIMGNVSAGMAVLQPES
YVGSSSPRRVRKLREVISKNTCDVLKAITNSP
Download sequence
Identical sequences G3NR24
69293.ENSGACP00000007790 ENSGACP00000007790 ENSGACP00000007790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]