SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007794 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007794
Domain Number 1 Region: 561-804
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.74e-79
Family Eukaryotic proteases 0.000000409
Further Details:      
 
Domain Number 2 Region: 366-454
Classification Level Classification E-value
Superfamily Kringle-like 1.35e-34
Family Kringle modules 0.0000372
Further Details:      
 
Domain Number 3 Region: 272-355
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-34
Family Kringle modules 0.0000619
Further Details:      
 
Domain Number 4 Region: 183-269
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-33
Family Kringle modules 0.0000456
Further Details:      
 
Domain Number 5 Region: 90-183
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-31
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 6 Region: 478-567
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-28
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 7 Region: 23-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.29e-16
Family Hairpin loop containing domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007794   Gene: ENSGACG00000005858   Transcript: ENSGACT00000007813
Sequence length 808
Comment pep:novel group:BROADS1:groupXVIII:3113723:3122456:1 gene:ENSGACG00000005858 transcript:ENSGACT00000007813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCNLALLLGALICSVGGTEVEGYAKTEGAWIIALHRREYSSNNVVECAAKCEAETSFT
CRSFMYIEKDQECWTAAANSKTETILRRSSAALYEKKGYLMECVNGLGTDYRGIKSQTKT
KKTCQRWAGRYPHKPNFTPEEHPLADLESNFCRNPDGDSGGPWCYTTDPNTRWENCEIAS
CTEECMQCSGENYRGKISTTANGYTCQRWDSQKPHNHGYIPSALPEKYLEENYCRNPDGE
TKPWCFTTSPSKAWDFCSIPRCTSEPPTIVPELTCATGEGGAYRGTIAVTESGKRCQSWS
AQTPHKHNRSPDNYPCKGLDSNYCRNPDNERTPWCYTTDPETRWEYCRVPSCGDAAGPGE
PVIPPEEEDCYKGDGTSYRGVTTETVSGKKCQSWSAMTPHKHQKTPQIYPQADLRRNLCR
NPDGDRAPWCYTTDPGVRWEYCNLEKCSTNPERRPPSPESTPNPTEIPPEIGKRPLIYCK
TGNGETYRGPTSITNLGVTCQAWNAQSPHQHTSFTQLSHPSRGLDGNQCRNPDGDVNGPW
CYTTDRNQKWDHCQIPDCDLLKCGTPVTKPRRCFGRIVGGCVSTAYSWPWQISLRTNTGI
HFCGGSLIHPQWVLTAAHCLERSKRPSAYKVLLGINTERANEPSKQERNLNKLVLGPNRA
DIALLKLESPALINDKVLTVCLPEKDYILPSGAECYVTGWGETQGTGGDGVLKETGFPVI
ENKVCNRPSYLNGRVKDHELCAGNIAGGSDSCQGDSGGPLVCYSQNRYVLQGVTSWGLGC
ANAMKPGVYARVSKFVDWIERTIKKMFM
Download sequence
Identical sequences G3NR28
69293.ENSGACP00000007794 ENSGACP00000007794 ENSGACP00000007794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]