SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007803 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007803
Domain Number 1 Region: 314-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000594
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 2 Region: 340-472
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 469-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000783
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 282-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000261
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007803   Gene: ENSGACG00000005896   Transcript: ENSGACT00000007822
Sequence length 683
Comment pep:novel group:BROADS1:groupXV:2164545:2168900:1 gene:ENSGACG00000005896 transcript:ENSGACT00000007822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWFPLVLAIVVSSFTQVLGSGVFELDLHHFQNTKGLLANGLSCSMTGCRTYFRVCLKN
FQTVVSPGDCLFGKVTTPVLGSDSFSVKRDAVLRLPLNFTWPGAFSLLIEARYSPAAVPP
ADTTNPESLISSFDIKRKLGIGHEWTPEVQRGSQTELRYSYRFICSEHYYGDTCSKICAP
RDDHFGHYTCRPDGQIACLPGWKGEYCQEPICLGGCNERNGNCTLPGECKCRKGWQGPFC
DVCKLHPSCKHGTCKEPWQCTCKEGWGGIFCDQDLNYCTHHKPCANGATCMNTGQGSYTC
ACMPGFNGVNCDLEVRECDSQPCRNGGHCLDSKNGYRCACPRGFEGTHCEHRMLTCADAP
CFHGGECREHDNGNTYICECLPGYTGLNCERKVDKCTSLQCTNGGHCVSHGALRLCSCRS
GFAGLRCEVNINECARDPCANGSTCVDGINDYTCACPPGRTGRHCEKPADRCASRPCLNG
GTCTAGAEGRPACACPGRYVGPRCQSSAAPPPVTPSPNVGWEAGDQLSLAAVCLGVGLVA
VLALLCAAVALIRHVRKRRRKEQDSETMNNLSKVDFQRENLISTLELKNTNKKVDCEVDC
PREKSNHKYINHYHLDYKTSPGYKDDMSLCRNRKTIEEKKHLSRMYRERPECRISTICSS
SNSMYQSVFGAEEKNECIIATEV
Download sequence
Identical sequences G3NR37
ENSGACP00000007803 69293.ENSGACP00000007803 ENSGACP00000007803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]