SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007895 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007895
Domain Number 1 Region: 588-722
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.01e-38
Family Mannose 6-phosphate receptor domain 0.00025
Further Details:      
 
Domain Number 2 Region: 274-423
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-37
Family Mannose 6-phosphate receptor domain 0.00000593
Further Details:      
 
Domain Number 3 Region: 120-270
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.4e-36
Family Mannose 6-phosphate receptor domain 0.00000397
Further Details:      
 
Domain Number 4 Region: 1315-1458
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.41e-36
Family Mannose 6-phosphate receptor domain 0.00087
Further Details:      
 
Domain Number 5 Region: 1025-1169
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.66e-33
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1177-1312
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.16e-30
Family Mannose 6-phosphate receptor domain 0.00049
Further Details:      
 
Domain Number 7 Region: 725-879
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-30
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 8 Region: 432-579
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.79e-30
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1467-1606
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.19e-30
Family Mannose 6-phosphate receptor domain 0.0000563
Further Details:      
 
Domain Number 10 Region: 1611-1754
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-28
Family Mannose 6-phosphate receptor domain 0.00087
Further Details:      
 
Domain Number 11 Region: 1966-2093
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-24
Family Mannose 6-phosphate receptor domain 0.00096
Further Details:      
 
Domain Number 12 Region: 2096-2241
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.71e-24
Family Mannose 6-phosphate receptor domain 0.0017
Further Details:      
 
Domain Number 13 Region: 890-1026
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-21
Family Mannose 6-phosphate receptor domain 0.0018
Further Details:      
 
Domain Number 14 Region: 1-108
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.98e-21
Family Mannose 6-phosphate receptor domain 0.0000735
Further Details:      
 
Domain Number 15 Region: 1764-1857,1908-1951
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.66e-19
Family Mannose 6-phosphate receptor domain 0.0027
Further Details:      
 
Domain Number 16 Region: 1856-1906
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-18
Family Fibronectin type II module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007895   Gene: ENSGACG00000005960   Transcript: ENSGACT00000007914
Sequence length 2467
Comment pep:novel group:BROADS1:groupXVIII:3138884:3167789:-1 gene:ENSGACG00000005960 transcript:ENSGACT00000007914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSYKWEAFDKDNKVSYTLKLCESSPATACGPGTAVCAQNLTAGDNRSVGELSLQTLSGTV
LDYNSTEKCVGSSNNVQTSISFQCGKTLGTPEFAVSQCGHYFEWRTLHRPARKTNSSHPK
EVPCYVFDSDWKKHDLSPLIKVNDGYLVDDGDDRIDFYINICRSLSQYPREGGEADKSCP
EGSAACLVTSHGSYNMGSPTTQLELSSNDRLKLHYEVAADSQSPDICNGHQPAVTLTFIC
PSSRHSGSTPKMTAGSNCRYEVEWVTEYACHRDYLESHSCKMTSKENDIAIDLTPLTLSY
QPYHAHSGPTDGDESYVYYLNVCGNIPTEECGEHQLVSSCQVKKSGDVKKVAGRFQNQTL
RYSDGDLTLIYPDGSRCSSGFLRMTIINFECNKSASDGGRGNPVFAGETDCTYYFDWETA
FACVKEKEDLLCRVRDDNKHYDLSPLTRYPGSDVGGNWEVVDAKSPNPDSRFYLNACHKV
VQTGAAVGCPVNASICAVGKNKDNVTISLGSFLSSPQKIGEDIRLVYTNGSFCINKRTRI
QTVLTLKCKPGNLESAPVLRSVSSDGCVYELEWYTAAACVLAKTQGDDCKVEDPQAGFSF
DLSPLSKANGGFYNLTSGNYHYYINVCGPVKAASCPEKAGTCQVDEKRSWSLGEANSRLS
YYDGLIQLTYNNGSKYNNDRHTLRSSVISFLCDPEAGAGYPEFQVEDNYTYNFRWYTSYA
CPERPHECLVTDPKSLEQYDLSSLSRPTSITNWQAMDLSDTLNLKKYYINICRPINPVPG
CDRHASVCQMKYTSDQVCDKEVVSVSNMGISKRGPIIEEQDRLLMAFTDGSSCESDGQEL
SYTTLIHLVCSRGSVSMAPRFLMYQNCTANFMWETRAACAIKTTTTTNNNCSVVDPNTGF
EFNLQLLASKTGYKTNANGKDFLVNICSDVAECGPGMAGCELDEGHPSSPVGVEKTLQYS
TDGLLTLTYKGTLDEPTATRDTFTIHFVCDPTAHPGSLKLLQEDLSSLQSHVVHNVFFEF
STALVCVPAPVDCQIIDLHGNEYDLSHLMRDRDDSPWIAIDTDAVKSQSFYINVCKPLPP
SSECPVGPLGACGIIDGKSSNLGYVQSRPRVAEDGSISIVYQNGDQCGSTSRYSTRIIFL
CDENPGSPMFDRKDGCEYVFIWRTSEACPIRKSQGDDCRVRDPKSGYEFNLSSLKGQDHS
VTSNNYVYHLSICEGLHKGICTHKETAPDAVSSCQVEGKTHKIAGVASQVLSYVGDQLIL
NYTNGEVCHKIYNRSTEIYFSCHPDRHPGKPEFIKETPDCTYLFSWPTALACVPVKTTSC
SYKDDQGHSYDLSPLAMDSRNWEVEPSTEDTKNRFFINVCRSLVQQGGTQKCPSSAASCL
KAGEDYVNLGQVESGPTWDGNVLKLQYTSGQACPDGRRKRSSVIRFKCDRDKVDSRPTLI
SAIEDCVYTFIWLTAAACPLNSSQHDNCRVTNPATGHMFDLNPLTKKGGYTVYDPQEHRK
MFRMNICGNVSNAGCGSETAVCIKDAATAVSGGQVSRELSYKNQVLELTYEGGSTCPANR
TLKHNTIIHFICRSSCMGSSPPEPVLIDSNAETCTHFFSFHTPLVCEQPVRCSVQNGSAL
IDLTPLIHIGGYYTAMDEAVDQGDESPDFYINICQPLNPIPGVTCPPGAAVCKDPDDGPP
VDIGRITSGPEINSATGEVSITYNSSTKCAADPAQNYTSTIVFTCQRGLDLGSPEMLRLQ
ECVYLFEWATPLVCSDATRTNTSGCQLTDSQLQFTFELSVLSGIVEVAASSSVYRINVCG
SVPDTGCKKSAVCRVSGSGSDMSASSFGISKAMTMDYKHDEDAVLMQYGGGDPCPPVTNE
GEACVFPFTFMKKSYTECTKDERTDGRMWCATTADYNKDKKWGFCNAASGKRQSSILFTC
DESAGRGSPQLLSETAGCSATFQWRTSAVCPPMKMECELVSRHQTFDLRTLSSLTEPWKF
RHQGDSYFINLCQGIHGRSHGCPGGATVCRHTAAGVNQTLGRVYTQKMSYDDGKITVSYS
AGQDVCGNGVQAKTVIQLSCGSTVGHPALISVNKATCEFVIGWETQSACAVKQHEVQMVN
GTIQVPDTGASLNLGKLYFSHHQASGDIRPNGDRYIYHIQLSGITNNSLPICVGANICQV
KLNGNNRRRIGSSNEARYYVKGGNLDVMVPSQSPCGREKKKMVSSTIMFHCNPSAGVGIP
EFMLETDGCQYLFVWHTDAVCGLTVDVGTEDSVDGDASLFSGRRPATGLVLSLLLVVLSV
GLLGLLLHKKERRELVIQKVVGCCRRGNQVSYKYSKVNMDEEGGEEEMEWLMEELEATPS
SSHRGKKNHGNGHITTKPVNADGLRSFSLDEQNDEDDSEDEVLSVPGVRVVKSSGNSRRS
SAHRGPFLQVPETSVQASDEDLVGLLDESERKRQGRKPRSAGLNNGNGTAANRKRDEDDS
DEDLLRV
Download sequence
Identical sequences G3NRC8
ENSGACP00000007895 ENSGACP00000007895 69293.ENSGACP00000007895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]