SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007957 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007957
Domain Number 1 Region: 853-1066
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-105
Family Thrombospondin C-terminal domain 0.00000000377
Further Details:      
 
Domain Number 2 Region: 6-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.07e-36
Family Laminin G-like module 0.000000554
Further Details:      
 
Domain Number 3 Region: 757-851
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.37e-24
Family TSP type-3 repeat 0.00000505
Further Details:      
 
Domain Number 4 Region: 416-471
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000301
Family TSP-1 type 1 repeat 0.0000526
Further Details:      
 
Domain Number 5 Region: 295-352
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000439
Family VWC domain 0.003
Further Details:      
 
Domain Number 6 Region: 617-700
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000759
Family TSP type-3 repeat 0.00011
Further Details:      
 
Domain Number 7 Region: 689-759
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000288
Family TSP type-3 repeat 0.0003
Further Details:      
 
Domain Number 8 Region: 363-412
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 
Domain Number 9 Region: 472-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000887
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007957   Gene: ENSGACG00000006010   Transcript: ENSGACT00000007976
Sequence length 1068
Comment pep:novel group:BROADS1:groupXV:2296800:2303009:-1 gene:ENSGACG00000006010 transcript:ENSGACT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRGDNSVYDLFEMARVNKRHNGVTLVKGVDPHSPAYKVLNADLIPPVPDSYLRDLLDSIQ
AERGFLLLVNLKQFKKTRGSLLTIEKKDGSGSIFEIISNGKANTLDVVYSTLSQQQVVSI
EDADLATGHWKNVTLFVQDDRVQLFVGCEEINVSEMDLPISKVLSQELADVARLRIGKGV
VRDKFMGVLQNFRFIFGTPLDAILRNKGCQSGATLTDVLTLNNPVNGSSPAIRADYTGHR
TKDPQAVCGFSCEDIAGMFKELKGLGVVVKQLSNELRKVSEDSTLLKNQMNIPGGICIHN
GFEHKDKDEWTVDSCTECTCQNSATVCRKISCPLMPCANATVPDGECCPRCGPSETPSES
VTEDGWSPWSDWTHCSVTCGRGIQQRGRSCDRINSNCEGTSVQTRDCYPQECDKRFNGGW
GPWSPWDTCTVTCGGGVQTRKRLCSDPVPKYGGKDCVGDASLSQLCNKQDCPIDGCLSSP
CFPGAKCASFPDGSFRCGRCPPGFSGNGVACKDIDECKEVPDACHTHNGVHRCENTEPGY
NCLPCPARFSGPQPFGRGVEQATAKKQVCKPRNPCQDGSHDCHRNANCIYLGVFSESMYR
CECKPGYAGNGRICGEDSDLDGWPNIDLHCVENATYHCKKDNCPNLPNSGQEDHDKDGLG
DECDRDDDNDGIPDDRDNCPRVYNPAQYDADRDDIGDSCDNCVYEANTDQTDTDNNGEGD
ACAVDIDGDGILNENDNCPYVYNVDQRDTDRDGVGDHCDNCPLEHNPDQFDSDSDRVGDK
CDNNQDIDEDGHQNNLDNCPYIPNANQCRLAFNPDQLDSDGNGRGDVCKDDFDQDNILDI
HDVCPENFAISETDFRRFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYDE
FSAVDFSGTFFVNTDRDDDYAGFVFGYQSSSRFYTVMWKQITQTYWSHTPTRAQGYSGLS
IKVVNSTTGPGEHLRNALWHTGDTAGQVRTLWHDPKNIGWKDFTAYRWHLTHRPTSGLIR
VVMYEGKRIMADSGNIYDKTYAGGRLGLYVFSQEMVYFSDLKYECRGK
Download sequence
Identical sequences G3NRJ0
69293.ENSGACP00000007957 ENSGACP00000007957 ENSGACP00000007957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]