SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008044 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008044
Domain Number 1 Region: 42-194
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.09e-22
Family Growth factor receptor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 196-250
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000654
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008044   Gene: ENSGACG00000006080   Transcript: ENSGACT00000008063
Sequence length 319
Comment pep:novel group:BROADS1:groupXX:5553263:5564403:1 gene:ENSGACG00000006080 transcript:ENSGACT00000008063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLQLISFVLIILHGMDNTGCQQHSSPRNRQHKQISGVSSGCQQGGCLTCSDYNGCLSCK
PRFFMHLERIGMKQIGVCMTSCPLGFYGTRSPERNTCTKCRSECDSCFNKNFCTRCRAGF
YLHLGKCQENCPEGLVRSDTQRECVPGCPAECEACVNSETCARCRPGLYQLGGRCHHVCP
EDYEPSDKLMECTPQVHCDVGEWSEWSPCSRSGRTCGFKRGQETRTRQVLQHPSPFGNPC
AEVSEFKECLVKRRKCPERGQLGGQGTKNMNRGGRKKNERRERRNRNNRKDTGEREDLDN
RNKTEHRHRRGHDTDPASP
Download sequence
Identical sequences G3NRS7
ENSGACP00000008044 ENSGACP00000008044 69293.ENSGACP00000008044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]