SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008154 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008154
Domain Number 1 Region: 525-594,727-959
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.62e-65
Family Protein kinases, catalytic subunit 0.00042
Further Details:      
 
Domain Number 2 Region: 997-1325
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.41e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0042
Further Details:      
 
Domain Number 3 Region: 272-485
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.61e-35
Family Protein kinases, catalytic subunit 0.00062
Further Details:      
 
Domain Number 4 Region: 5-63
Classification Level Classification E-value
Superfamily UBC-like 0.0000000000536
Family RWD domain 0.00056
Further Details:      
 
Domain Number 5 Region: 1328-1428
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00000216
Family Anticodon-binding domain of Class II aaRS 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008154   Gene: ENSGACG00000006146   Transcript: ENSGACT00000008173
Sequence length 1583
Comment pep:novel group:BROADS1:groupXV:2491362:2505659:1 gene:ENSGACG00000006146 transcript:ENSGACT00000008173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGTDRPPELQLKNAKGLSNENLQNLQSELAKLADARCGEVMIYELADYIQGFLSEHNKPP
PSSFHEEMLKNQRRQQEKRDQEEQQKVDQQRKRAEEMEKEIMAEIQRREEEKRDEKRRKE
IAKQVSAPFPPISSEKQLNTTLPRRRQPAAGGLPQTHGTGTRRTGRFSPPVLKRRCLKPR
PVSLPRRDTVNEDAPRSRELLRFSSSAFGELVVHRGKSLGVSERLRRSVHHGFEANSGDF
AVIYEWSLRWNKKMGKFFTSQEKGRLESCKKQASSIQGAEAEFNSLLRLDHPNLVRYMAM
SSTEKEDCLAVNLLVEHVAGFNLTRSLVANTPLATDKLCHYAAQLLAALDYLHANSVVHK
QLAASSVLVDSEGNVRLTDYSLSRRFADMCKEDIFEQAHVRFSEDAAMPTKTGKKGDVWN
LGLMLLALSQGKETQEYPVTVPASLPADFQDFLHKCLCLNDAERWTAQQLLDHAFLKPPS
PKHLPLHRNSSPEVPAVDFPSSVIPRSHIPYAPFSSGVERQFSRYFNEFEELQLLGKGAF
GAVIKVQNNLDGCYYAVKRILVNPASKQFRRIKGEVTLLSRLNHENIVRYYNAWIERHEI
PPSEAAWSAGDKSPQRKEPPRGVGGGAGEPGDGVEDAAPPPALSSSVEWSTSIERSSSAK
CSAPQSSDEEDDDDEDVFGASFLPSNSDSSSDIIFDNGDGSTGDMSQPSKRPATDTAESA
DSERPQRIAHYLYIQMEYCEKSTLRDTIDHGLHQDHNRLWRLFREILDGLAYIHEQGMIH
RDLKPVNIFLDSHDHVKIGDFGLATDHPANVAAGKCEAEESGSAVKPDPTGNMTGMVGTA
LYVSPEVQGTTKANYNQKVDLFSLGIILFEMSYRPMTTGAERISVLSLLRAVRPSPMNFP
EDFTAYEQGTQRKVIEWLLNHDPALRPTAQELLKSELLPPPQMEESELHEVLQHTMANIN
GKAYRTMVGQLFAQNTSPVMDYTYDIDLHKGSFSLNSAKLQQHVYETITRIFKRHGAVRL
QTPLLLPRNRKLYDGSEPACFMDHSGMLVTLPYDLRMAFSRFVARNNITHLKRYSIERVF
RPRKLDRAHPRELLECAFDIITPVTNSLLPDAETIYAVSEIVQEFAALQERNYNIYLNHT
SLFKAILLHSGVPEDKLSQASTILCDAMSEKLTKREVEAKFCNFSLSTNSLQTLYKYIEQ
KGNLQDLAPLLTALTKQKTAVTQLAKQGLKDLEEVTALLRGLGVKLQVVVNLGLVYKVQH
HSGIIFQFVAFIRKRKRIVPDILAAGGRYDHLIVEFRGPASTAQVPSAVGASVALDKVCA
AMTNMEEPPSVSCCDALVVPVGQSSMSRAISVVQKLWSTGVSADIAYDVLQSQDTLMEHC
RLAAISCMVLVSDKEGNYVKVKSFEKDRQSEKRIPESDLVDHIIQKCRTKFFEERNIRET
SDSMSQNPKGSSLNTTGMMSTSSTTNINVYVISPEKVSSNARRRYETQIQTRLQNLGTNL
QNKSNDIEVLAVDLLKETLVHFLSLEFDSEEQFNSSVKTLLNRLPKQRYLKSICEEIHHF
KIMKKVAVVILYSYKDDYYKILL
Download sequence
Identical sequences G3NS37
ENSGACP00000008154 69293.ENSGACP00000008154 ENSGACP00000008154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]