SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008231 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008231
Domain Number 1 Region: 719-909
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-54
Family Protein kinases, catalytic subunit 0.00000171
Further Details:      
 
Domain Number 2 Region: 120-194
Classification Level Classification E-value
Superfamily HR1 repeat 1.11e-23
Family HR1 repeat 0.0000721
Further Details:      
 
Domain Number 3 Region: 201-278
Classification Level Classification E-value
Superfamily HR1 repeat 5.23e-23
Family HR1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 19-97
Classification Level Classification E-value
Superfamily HR1 repeat 1.57e-20
Family HR1 repeat 0.00022
Further Details:      
 
Domain Number 5 Region: 313-339,381-471
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000425
Family PLC-like (P variant) 0.023
Further Details:      
 
Domain Number 6 Region: 585-646
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000236
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008231   Gene: ENSGACG00000006215   Transcript: ENSGACT00000008250
Sequence length 928
Comment pep:novel group:BROADS1:groupXI:2627552:2637707:-1 gene:ENSGACG00000006215 transcript:ENSGACT00000008250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLFSPPQSDPGGLSVLQQLGLDQNSDFSDSSVQQCLDEHRERIRREIRKELKIKEGAENL
RRATTDKRNAQQVDSQLRSSNRKLESLQTQLQELDAHIVVKGPDESKDDHQSPGAPNRVS
ANQQRIAALDRQLNIELKVKQGAENMIPIYANGGTKDKKLLQTAQQMLQDSKTKIDIIRM
QIRKAMQATEQSEDSQSKPDMCGMELRMEELWHHYRVEHAMAEGAKNMLRLLGAGKVQDK
KAMAEAQCGLSGASQRLDLLRCSLEQRLQELPEDHPKACLIKEELVLATSSAFSSRHSTP
YVHNQYSTMSKPSPLTGTLQVHLLGCVGLLEVVPGRSRGTPLVLPSYSVGDGRSSFKLSG
LYSRSTSSMSLKIPGKNEELSSEVSAVLKLENTVVGQTVWKTVGEQTWDQTFIVELERSR
EMEIAVYWRDFRSLCALKYLKLEEFLDNQRHQVQLELEPQGLLLAEVIFFNPVIERGRKL
QRQKKVFSKQHGKAFVRARQMNVDIATWVRLLRNAIPTGSNVPAYTASFTGNMPSAGWVT
STPANPQNSSDSPPKVLSLFPPQEQTPVIEAPSTPDVPVHEQQQQPTRSLSIPSRGPLCL
QDFKLIAVLGRGHFGKVLLSEYKRRGSLYAIKALKKGDIVARDEVESAVSTRRGLFASVS
PPHPPPPPHYSHRSRPAKSSSARMVLRKGSFGVGANSDFLNKRTRYFTQAIQWGYFPXDH
KIVYRDLKLDNLLLDTNGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTR
AVDWWGLGVLVYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNP
ERRLGSGEKDAEDVKKQPFFRDVDWEDLLQRKVPPPFVPTIVGKEDVSNFDVEFTAEAPA
LTPPRERRTLSRKEQDHFKDFDYVSDLC
Download sequence
Identical sequences G3NSB4
69293.ENSGACP00000008231 ENSGACP00000008231 ENSGACP00000008231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]