SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008301 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008301
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.2e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00057
Further Details:      
 
Domain Number 2 Region: 771-947
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-36
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 320-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-31
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 4 Region: 126-317
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-31
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 5 Region: 955-1160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-28
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 6 Region: 565-620
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000384
Family Fibrinogen C-terminal domain-like 0.0038
Further Details:      
 
Domain Number 7 Region: 534-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000587
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008301   Gene: ENSGACG00000006258   Transcript: ENSGACT00000008320
Sequence length 1296
Comment pep:novel group:BROADS1:groupVIII:6590106:6632290:1 gene:ENSGACG00000006258 transcript:ENSGACT00000008320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEACDSPLVGSLPPPSFRSSSQLTSSHGPVFAKVNRREGAGGWSPLVSDRYQWFEVDLG
RRTCITAVATQGRYGSSDWLTAYLLMFSDTGHNWRQHRQEDSFGAFPGNSNADSVVKYKL
KQPVIARYLRLIPLDWNPSGRIGLRLEIYGCRYTSDVANFDGSSSLVYRRSARPSWKAME
VVSLKFKTHKNSGTLLHAEGKRDDSLTLVLEKGRLLLYHQQGIKSIPSTLFFLNLTVGSL
LDDQHWHHVKLQRLSTHLNLTVDKNTRQVHTPAELIHWDINQFLVQLSLGAVQSHGLQKP
ILSNKNFHGCMENLLYNDLNLIHLAKRNNHQASVVGNVTFSCAEQVSVAVTFTHSQSFLQ
LPGLTSWSSGVVSMALQFRTWNKAGLLLTFNLLQKGGTVWLYLSEGRLRLQINKAGRAEL
ELSAEKGSGLNDGQWHYVELNSRHDHLSITVDTDEGATAHTSIPLLLTTDSQLFFGVGCP
AQEGSPQCKNPFKVFQGCMRLLTVDNQPVDLIKVQQRLLGKYSHLQIDMCGITDRCSPSR
CEHGGRCTQSWSTFHCNCSNGGYRGATCHSSKYEKSCEVYKHKGNTSGYYHIDVDGSGPI
KPQLIYCNMTEDVSWMVIRHNNTELTRVHSSPDRHGHLAHFDYASEEEQLAAVISQSERC
EQELSYLCRKSRILNTPEGAPLAWWVGGAGPGEIQTHWGGALPGSRQCACGLQDNCLDSN
HYCNCDADLEQWANDSGLLTHKGSLPVRSLVLGDIQREGSEAAYRVGPLRCHGDRNFWNA
AFFDKETSYLHFPTFHGELSADIAFLFKTKSSSGVFLENLGIKDFIRIELRSASEVVFSF
DVGNGPLEVRVETSVRLNDNRWHSIRAERNVKEASLRVDGFPAAVHEAPADGHTQLQLNS
QLFIGGTASRQKGFLGCIRSLQLNGVTLDLEERAKVTPGVRPGCPGHCSSYGSLCQNQGR
CVERVIGFSCDCDQSAYTGAFCHEEVSASFKSSTSVAYKFKESYEAKRNISTSPFSIYSD
LTLRGENISLSFRTSQCPALLLYVNSFHREYLALLINKHNELELRYKLHGSRDVEVMGSG
VTNLADGLLHTVTIRRLADAVTVQIDQNAKEHFSLTSDMEFNGIKSLILGRVQEFEEVDA
ELSSLASLGFTGCLSGVCFNSISPLKAALLHPDSPVIVSGPLVQSSCGGSSTSANPYTTE
TTHSLSDQPGSVDPGQPLVNSIRSDSVLVGGVIAVVTFVTVSAMAIMGRFICSRKETYRK
QEVKTAAQPEDCHELPFSGRAESLGAPSENQKEYFI
Download sequence
Identical sequences G3NSI3
ENSGACP00000008301 69293.ENSGACP00000008301 ENSGACP00000008301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]