SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008432 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008432
Domain Number 1 Region: 1528-1697
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 1692-1878
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-31
Family Laminin G-like module 0.00086
Further Details:      
 
Domain Number 3 Region: 1105-1285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-24
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 1289-1459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-22
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 5 Region: 888-1084
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-19
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 6 Region: 158-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family Laminin-type module 0.002
Further Details:      
 
Domain Number 7 Region: 212-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 8 Region: 108-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 9 Region: 267-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008432
Domain Number - Region: 50-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008432   Gene: ENSGACG00000006339   Transcript: ENSGACT00000008451
Sequence length 1879
Comment pep:novel group:BROADS1:groupXVIII:4441380:4464154:1 gene:ENSGACG00000006339 transcript:ENSGACT00000008451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIHQTVSVCFLLFLQTAIVCLIEWCSFKVVQRVCAKGFFLSEQSICLPCNCKGHADYCE
DITGVCINCRDHSTGDFCEMCEDGHMLARSLDGQHSCPPCACPLSVHSNNFAVRCDKGGG
SLRCKCQEGYAGHLCERSRCSPGFYGNPMVIGNSCKRCNCNSNSDPNLIFNECHNVTGHC
QHCWGNTAGANCERCAPGFYGDAISAKNCKECECNACGTSSCDDRKGVCHCKPGVTGRLC
DQCEEGYFGFSGCQGCRRCECGPASIRPTCHPLTHSCPCRPGAGGRYCERCLPGYWDYSS
AGCQKCDCESGHCDMHTGECLAESATVNLCNISCDECIWHLIGDLRMSNKTLDQLKVGVL
NISTGAAANDRLKYYNYTAQQLQTQFQGWRNKSSLIKPQTLELEKATDAVVMDIKQLGES
ESVVKTLGNVLQNDTLETVTLAEQLSTNLTDLNLRIEEMIHDWELYSVHQDVDPEVAKQN
TEQAYAMVTWMRALDLSPREPIATDESTEAHDLLRRIRQLEKKLMITDGRLSPVREILSR
LSAKLSDAQSFLQKASGTVQETEDMNRASILKLQRSEVKQQRLVEDLATVNNTLGIARGS
ISETNRTLVEVDAMGENLTKYHAAIDGAGQRLMEKTERLSLADRDLVQRADVHANELNRQ
ANELEDDLRKSDANGFVQKAISAANVYNNIVKYIDDANITSLTTHNLSHRAEDAITGINM
QLKYLVRQSNQVLKESVSLRSEQDVVEHEVADKLIYIEETKETVGKNTQKLAEIVEDISG
IHADRTPQRLEFTLSVAEGTLNHSAEVLHTINPISTKVEKWANNMKKNDYSTVAYEQAVL
SAGEAVESLNVLVPKLLDKLKVVEEKKPVNNVTTNIMRIRELIAQARSVAKKVQVSMKFN
GQSLVEIHPHSNPEDLKTVTSISLFLRVDPDKDPIEDRFILYLGNRNGSKDYMGLAIKSD
NLVFVYNLGGEDVEISLGSKPVSQWPAVFNYIKVERLGRHGKVFLTIPSQSSNDEQKFIQ
KGVAPGTDSLLDLDPKDIVFFVGGVPQDVRLPPLLSLAPFVGCIELGSLNNDVISLYNFK
ETHKMNVVTSTPCLRYKLAFSQSRIASYLFDGTGYALINNIERRGKFGVVTRFDISVRTV
ANNGVLLLMVNGDNFFLLELKNGFLRLMYDFGFSKGPLLMENNSSKLQINDARYHEVSLI
YHQSKKVILLVDKSHVKSFENPKTTLPFSDIYIGGAPSSILKSRPELSAVVGLKGCVKGF
QFQKKDFNLLEEPGTIGISSGCPEESFMSRTAYFTGESYLGSTAKISPFDNFEGGLNFRT
LQPIGLLFYLNEGSDEFSISLENGAVVLNSRGTRVKSHKKQYNDGRIHFLVASVNNQKYS
LMVDDRDKQEKKRPSSASRSSSGSEVKTFYYGGSPSSNFKNFTGCISYAYINRQDRDIEP
EDFQRYTEKVQTSLQDCPVQRPPAALLSRHREQTSRAKQGPSHKVSKEMSSLPLGLMELK
SDDQEPYDLNVEPCYLSSSPRATRQAFHYGGLANSRQHYKDLPDSFSKRSHFSLSLKTHS
SFGLIFYVSDVQEENFMALFLAHGKLVYTFNVADQRVKIRSEEKYNDGAWHNVVFIRDGS
IGRLIIDGLTLLQDRVQEGNISWNVTSPFYVGGVPPDRAQKNIQRNSAYSFTGCLKNIQL
DGQWLSSVSETFGVTPCFEGLSEAGTYFSKDGGYVVLDETFNLGLKFELRMEVRPRMASG
VLLNVRTSEGYFTVYLHQGAVVVLVNEGSHEFFTKVSARHGLCTGKWHRITVIRDANVVQ
LDVDSEVNHVVGPLDSGSTDTRKPLFIGGAPDLFLPESITTRSPYVGCMRNLTINNSRVS
FSKAVLASGAVSVGTCPAA
Download sequence
Identical sequences G3NSW4
ENSGACP00000008432 69293.ENSGACP00000008432 ENSGACP00000008432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]