SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008572 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008572
Domain Number 1 Region: 134-381
Classification Level Classification E-value
Superfamily vWA-like 7.11e-83
Family Integrin A (or I) domain 0.00000000523
Further Details:      
 
Domain Number 2 Region: 377-466
Classification Level Classification E-value
Superfamily Integrin domains 3.98e-30
Family Integrin domains 0.000011
Further Details:      
 
Domain Number 3 Region: 638-722
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.31e-23
Family Integrin beta tail domain 0.0000293
Further Details:      
 
Domain Number 4 Region: 27-84
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000785
Family Plexin repeat 0.00035
Further Details:      
 
Domain Number 5 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family Integrin beta EGF-like domains 0.008
Further Details:      
 
Domain Number 6 Region: 596-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family Integrin beta EGF-like domains 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008572
Domain Number - Region: 523-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008572   Gene: ENSGACG00000006460   Transcript: ENSGACT00000008591
Sequence length 795
Comment pep:novel group:BROADS1:groupV:8313280:8325132:-1 gene:ENSGACG00000006460 transcript:ENSGACT00000008591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALPTRGVLWMRVLMFTGITGVCGLNVCTSRGASTCKQCLAVHPSCAWCFQEDFGQGAA
SSSRCDLKSNLAAAGCALSALESPASKLQVIEDRPLSNKAAGATQDVTQIQPQKLQITLR
PDDAKRFTVKVRQVEDYPVDLYYLMDLSYSMNDDLFRLRTLGKGLAEAMNRTTSNLRMGF
GAFVDKPISPYMYISPKQAVKNPCYSINTTCLPQFGYKHVLTLTEEVGRFTEEVKKQMVS
RNRDAPEGGFDAIIQAAVCKEEIGWRPGASHLLIFTSDAKTHMALDGRLAGIVRPNDGKC
HLNSDNMYSMSTTMDYPSLALITEKTSENNINLIFAVTNPVVPLYQNYSELIPGTTVGTL
SNDSGNVIQLILKAYAKIRSKVELELQGVPEELSLSFNATCLNGEVIPGLKSCSGLKIGD
TVSFSVEARARGCPKEKKKSFIIKPVGFKDSLSITVDFECDCKCQAEAQPDSPACNHGNG
TYECGICLCHPGRLGPHCECAEGDYDPTEQDRCSGPAGSGGPQSAICSGRGDCVCGQCVC
HGSDFGKVWGKLCECDDFNCLRYKGELCSGHGVCNCGFCQCAPDWQGDNCNCSRRTDTCM
SHLGLLCSGRGQCACGACECTQPGAYGATCDKCPTCPDACTMKKECVECKHFKRGTLFDG
NTCSRICKDEIVLVDKIVLHDTNAVNCTYKDEDDCVERFQYYEDTSGKSILFVVKEPDCP
KGPDILVLLLSVAGAILFLGLAALLIWKLLVTIHDRREFAKFEEERARAKWDTGHNPLYK
GATSTFTNITYRGKE
Download sequence
Identical sequences G3NTA4
ENSGACP00000008572 ENSGACP00000008572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]