SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008626 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008626
Domain Number 1 Region: 218-473
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.35e-78
Family Eukaryotic proteases 0.00021
Further Details:      
 
Domain Number 2 Region: 103-210
Classification Level Classification E-value
Superfamily Kringle-like 2.25e-30
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 3 Region: 4-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000325
Family EGF-type module 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008626
Domain Number - Region: 46-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008626   Gene: ENSGACG00000006512   Transcript: ENSGACT00000008645
Sequence length 477
Comment pep:novel group:BROADS1:groupV:8375169:8379475:1 gene:ENSGACG00000006512 transcript:ENSGACT00000008645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVTDECDPNPCLNGGRCDHAADGSFRCSCPESYSGKKCQKVKDVCKNVKCGHGSCIYTS
TAPFYECKCKHPYRPPNCTKASRCRPNPCQNGGSCMSPKRSSFQCFCPDGYSGKFCEVGP
NDCYRGDGETYRGTVSVAVDGEECLDWNSYFILQKGSNPFKEYAGFDGIGPHNHCRNPDG
DDQPWCYINRNGRLKWDYCKVRECSETGPPAEPEVPAGQFSACGRPQPGRTARIFGGRKS
QPGAHPWQVSLQTRPEGSVESFDHVCGGILIGTCRVLTAAHCIKSGVEMQVVLGGVDLEK
DEIYDQVIPVEKAVVHEDYRETPFVLYNDIAMLQLKVTNTPYCANETRFVKTACLPKQPF
ASGTECVISGWGATETQKYGTNQLLDARVLLISQEKCKAPHVYGTSLDDSMFCAGTLQGG
VDSCQGDSGGPLVCERNGTHYVVGVVSWGDGCGKKYKPGVYANVGRFVDWIARRLLS
Download sequence
Identical sequences G3NTF8
ENSGACP00000008626 ENSGACP00000008626 69293.ENSGACP00000008626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]