SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008666 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008666
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000000144
Family Toll/Interleukin receptor TIR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008666   Gene: ENSGACG00000006557   Transcript: ENSGACT00000008685
Sequence length 52
Comment pep:novel group:BROADS1:groupI:3347259:3347414:1 gene:ENSGACG00000006557 transcript:ENSGACT00000008685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSLRCFLMQRDACPGGAISTELCQAVQDSHLRALLITPDFLRDDWCQYMMHQ
Download sequence
Identical sequences G3NTJ8
ENSGACP00000008666 ENSGACP00000008666 69293.ENSGACP00000008666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]