SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008677 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008677
Domain Number 1 Region: 248-453
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-53
Family Reprolysin-like 0.00042
Further Details:      
 
Domain Number 2 Region: 543-600
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000863
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 948-1007
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 1097-1152
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000706
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 890-946
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 1013-1074
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008677
Domain Number - Region: 838-886
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00484
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008677   Gene: ENSGACG00000006552   Transcript: ENSGACT00000008696
Sequence length 1196
Comment pep:novel group:BROADS1:groupXX:6573466:6609922:-1 gene:ENSGACG00000006552 transcript:ENSGACT00000008696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYELVSPYEVNPRGVHISYEVAHNQRRRRRRSLAQDAAGSPTNDAGSKTIHFRLSGLGQD
FHMELREASESLIAPGFTIQVLGKNGTKSLRAYHQDDLCFYQGSLRSDVNSSVALSTCAG
MSGLIRTQDADYFLRPVSHRLARRENFTAPSDHQPHILYKSDREPRAEGERKGDISRGDQ
PERHGRGHRRTRRRLDGDRTHGEKQRQHFCGRRKKYMPKPPEEDAFILPDEYEINLRNKR
AVQNQANQKLNVETLVVVDRKMMENHGHENITTYVLTVLNMVSSLFKDGTIGGNINIVIV
GLVLLDEDQDGLVINHHADHTLNSFCHWQSTLGGRQGRHHDHAILLTGLDICSWKNEPCD
TLGFAPISGMCSKYRSCTVNEDTGLGLAFTIAHESGHNFGMVHDGEGNVCKKSEGNIMSP
TLAGHNGIFSWSDCSRQYLSRFLNSAQAVCLSDEPRAVKEYRYPEKLPGELYDADTQCKW
QFGEKAKLCTLDFKKDICKALWCHRVGRKCETKFMPAAEGSACGPDMWCRRGQCVKQGDE
GPTPQHGQWSEWSPLSACSRSCESGVTYRERQCNNPRPAYGGKFCEGTSRSYKLCNTEDC
PPNAADYRAQQCAEFNGKQFRGWYYSWRPYTRVDDQDVCKLYCFAEGYDFFFALASKVKD
GTLCSQDSSNVCIDGLCEKVGCDRVLGSTAVPDACGVCSGDNSTCKIYKGQFTKQYHTNQ
YYGVLTIPAGARSIRVMELNTSSSYLAVRDTQRRYYLNGHWTVDWPGRHPIAGAIFEYKR
PYNRPESLMSTGPTNETLVVEILLQGRNPGVRWEYTLKKADEKKSHVKHNYTWAIIRSQC
SATCAGGQMNTKSACYKDLRVQVNTSYCNPRSRPATGLMPCNTQPCPASWSVAEWGGCSR
SCGGGEQMRLVRCEQRSGPTGADALADARCAQPTPARRQACNTRSCPPVWTAGPWSQCSR
KCGSGLRKRTVLCTNTNPGVRTPTLTDTLCAGLSKPTSQESCFIKRCQKQRKVQWFVSTW
QECSATCGRGNQARFIKCAEKDTAGKYRELAAKKCHHVPKPSVELHRLCIQAECPIQTTP
AAHRWSMHHLTRPPQPPPQAGWQSSPWSQCTVTCGGGVQVRTAQCLVQGKPSPACGLHLK
PSMSQACNTNFCQQPEKKDLACRDYFNWCYLVPQHGVCNHKFYGKQCCQSCSNSNL
Download sequence
Identical sequences G3NTK9
69293.ENSGACP00000008677 ENSGACP00000008677 ENSGACP00000008677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]