SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008726 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008726
Domain Number 1 Region: 21-192
Classification Level Classification E-value
Superfamily vWA-like 1e-47
Family Integrin A (or I) domain 0.00036
Further Details:      
 
Domain Number 2 Region: 505-690
Classification Level Classification E-value
Superfamily vWA-like 7.79e-46
Family Integrin A (or I) domain 0.00076
Further Details:      
 
Domain Number 3 Region: 276-479
Classification Level Classification E-value
Superfamily vWA-like 3.71e-30
Family Integrin A (or I) domain 0.0018
Further Details:      
 
Domain Number 4 Region: 693-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008726   Gene: ENSGACG00000006595   Transcript: ENSGACT00000008745
Sequence length 757
Comment pep:novel group:BROADS1:groupV:8475650:8480598:1 gene:ENSGACG00000006595 transcript:ENSGACT00000008745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQEIQTSHENIQKINAAGEKVMKCSAAMDVLFLMDGSHSVGKGSFERAKHYAIQLCQALD
VGPDKVRVGLIQFGSSPRLEFALDSYTTKEELKKRMKKISHRGGATQTGLALKYALRKGF
PGGRNASAAARIAILMTDGRSQGNTVQAAAQLKEAGVVLFAVGIRHPNWEELHALASEPA
ESHVFFAEHLRDALNGLYTTLSAFSVCDATPAGCLVESFPCERKTLETVREMQGNYMCWK
GSKGYSPYASLCPHYRYNKVYRRHQTVCHRTLCPDPCDSRPCQNGGTCVSEGPEGYHCAC
PPGYGGDPHCAPALSLDCSVDLLFLTEASATLPLEGFLRLKSFLKRFLRTVVGSDSPSRV
GLAAFGGETRVEVPVGKFKGDLKGLLKAVEALQPIGGPTLTGQALQHVTRHGFVSAPVFA
DVTDDLPRVVVLLTASRAADEVVEPSKYARDREIFLIGVGPDYLREQLDNMTGNPQRTIT
YTPPELSAKIPELKAKICSVDTQGCLGQAVDLVFALDASGGVSPANFGVLRDFVRSLTVQ
FDINRDVAQVALVAYSRRATTVFNLDAHETGSAVLKAVDAADYMGGVASTGSALLHVRSD
VLTAARGARPGVNKAVVVVTDGSGGDDAVVPAQKLRDNGVSLFVIGIGDVQKERLLRITG
SEDHMIAVPFYEDLKYFEDVLVQMLCSEVKKPVNLCKPNPCMNDGTCILSGGSFRCRCDG
HEGPHCETKSSRSPSRGDLPRPAGLRKKSRQRKSHRE
Download sequence
Identical sequences G3NTQ8
ENSGACP00000008726 ENSGACP00000008726 69293.ENSGACP00000008726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]