SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008795 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008795
Domain Number 1 Region: 274-578
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-49
Family Kelch motif 0.0062
Further Details:      
 
Domain Number 2 Region: 708-842
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-23
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 3 Region: 49-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-20
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 4 Region: 986-1032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008795
Domain Number - Region: 909-935
Classification Level Classification E-value
Superfamily Plexin repeat 0.00204
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008795   Gene: ENSGACG00000006611   Transcript: ENSGACT00000008814
Sequence length 1352
Comment pep:novel group:BROADS1:groupV:8512022:8555233:1 gene:ENSGACG00000006611 transcript:ENSGACT00000008814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRYLVAYVLLFYFVLVTHATPQKPCDKNCLSGKCVNGSCVCDRGWVGDQCQHCQGRFKLT
EPSGYLTDGPINYKFKTKCTWLIEGYPNAVLRLRFNHFATECGWDHMYVYDGDSIYAPLV
AVFSGLIVPEIRGNETVPEVETTSGYALLHFFSDAAYNLTGFEIFYSVNSCPNNCSGHGK
CTPGNSAASRVYCECDKYWKGEACDIPYCRNNCGSPDHGYCDLTGEKLCVCNDSWQGPDC
SLTVPSTESFWVIPNVKPFGTSLARASQKAVVHEKVMWVVGGYTFNYSSFQMILNYNLES
GIWNTVPINSGPLPRYGHSLAAYQDDIYMFGGKLEAGWGNVTDELWAFNVPSRTWQRRNP
AVGPPAQAQIFAVEGHSAHCVLLEDGEALMLVIFGYSPIYSHISNVQEYNLRSNTWLVAE
TKGAVPQGGYGHSSTYDGASGSVFVHGGYKALPAKKYGLVDDLYRYDVNTRTWFILRESG
FPRYLHSAALLSGTLLVFGGNTHNDSSLSNGAKCFSADFLAYDIACDEWRLLPKPDLHRD
VNRYGHSAVVSNGSMYVFGGFSGVLLNDVLVYRPPSCRAFSAEEACVNAGPGVRCIWSGG
RCLPWEPSMANGSLGPAPFCPTKAVTVDERCYRFSDCATCTANTNGCQWCDDKKCLSASS
NCTSNVRNFTECPVRNEHVCSKLANCKSCSLNVNCQWDQNQSVCHASPAQQCSEGWSQVG
EACLRINSSHKSYDNAQHYCKNLNGNIASLTTSKQVDFVLEELEKLQQRDKRLSPWVGLR
KINVSYWGWEDMSPFTNSSLRWLPGEPSDSGFCAYLEEPQVSGLRANPCTAAARGLICEK
ATGNPNQSTRPACKKPCSLHTNCANCTSQSMECMWCGSTQRCVDSTTYVISFPYGQCLEW
QTLDCVAQNCSGLRTCSQCLEQPECGWCGDPSSTGKGLCTEGSYRGPMKRPLKQGQQISS
GDMILEPGVCPKDKGYEWAFIHCPACQCNGHSTCVNGSVCEQCRNLTTGPHCQTCMPGYH
GDPTNGGKCQACKCNGHANVCQVLSGKCFCTTKGIKGDQCQLCDSENRYLGNPLRGTCYY
NLLIDYQFTFSLIQEDDNHYTAINFMASPEQANKNLDMSINASENFNLNITWSVGSTAGT
ISGEEVPIVSKSNIKEYRDSFSCEKFTFRSNPNITFYVYVSNFSWPIKIQIAFSQHNSIM
DLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWASRRREQLMRERQQMASRPFASVAVALDS
RGEETELLQPVLDGAPKPVAMEPCSGGKAAVLTVLMRLPSGLSDLPPPGQSGIIVASALI
DISQQKPSDFKEKSQGFKSRKALPPAHQGTCV
Download sequence
Identical sequences G3NTX7
ENSGACP00000008795 69293.ENSGACP00000008795 ENSGACP00000008795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]