SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008841 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008841
Domain Number 1 Region: 12-282
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.45e-51
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 365-409
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000288
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008841   Gene: ENSGACG00000006677   Transcript: ENSGACT00000008860
Sequence length 414
Comment pep:novel group:BROADS1:groupX:9337981:9340101:1 gene:ENSGACG00000006677 transcript:ENSGACT00000008860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVKQLKRRFAEALQADDAHEVMQILHTGKLDVDTVLEVEDPGMVLASYKQGYWLPGYKLE
TSWANGIHVCVMHNAVETALVLLREGAAVNRTPNGMTPLHVACELSNGDCVALLLAHGAK
VNSPSLSGHTPLHYCVNGASVDCAEQLILKGANVDTASQNNEEDTPLHTAARFGVPELVA
LYLERGASVNAVNSLQETPLMTACFWAFDSKEQNYSQDHHLVCRLLLDHQADPNLREEDN
KTALHKAAWNCDHVLMQMLLEAGADTQAMDINGCAPIQYVLKVTGVRPMAVPERCYQLLL
NHNAARIYPPQFHKVLQACYDYPAAVEIMVNSYERLKPTKKWRAAIPDDCYKRHKDFYDS
LFAVCTDAPRSLLHLTRCAIRAGLAGFCHAGVAQLPLPLPMKKYLLLEPEGVLY
Download sequence
Identical sequences G3NU23
ENSGACP00000008841 ENSGACP00000008841 69293.ENSGACP00000008841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]