SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008857 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008857
Domain Number 1 Region: 86-345
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.99e-81
Family Eukaryotic proteases 0.0000104
Further Details:      
 
Domain Number 2 Region: 2-78
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-21
Family Kringle modules 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008857   Gene: ENSGACG00000006694   Transcript: ENSGACT00000008876
Sequence length 359
Comment pep:novel group:BROADS1:groupVI:7982340:7984539:-1 gene:ENSGACG00000006694 transcript:ENSGACT00000008876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCWSGDGSSYRGFASESTSGRRCLNWNMFTYSGASNGLGDHSYCRNPDESLMPWCRVRRG
RRIVREFCDIPRCTSAGPTPTSRPPSAVDTERTCGERSVQRLHKIVGGSFTPVESHPWVA
ALFHQRTGFLCGGSLIAPCWVLTAAHCFSDGESTTIRHLSVYLGKSAINATDADKEQRFT
VEKVIIHQKYNLDNYDNDIALLKIKSSNGGCAVRSSSARTVCLAPSHTQLPAGFQCSIAG
FGNERFFGHYSQIMKQAVVQLLPQTDCASQSYYGHLITENMLCAGSPDWSTDACKGDSGG
PLVCEVAGRMFLFGVVSWGEGCAKRNKPGVYTRVTNYNKWIEDGTGLSKYTKGFMYPQK
Download sequence
Identical sequences G3NU39
69293.ENSGACP00000008857 ENSGACP00000008857 ENSGACP00000008857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]