SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008869 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008869
Domain Number 1 Region: 28-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.0036
Further Details:      
 
Domain Number 2 Region: 99-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000429
Family Fibronectin type I module 0.083
Further Details:      
 
Domain Number 3 Region: 224-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000916
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008869   Gene: ENSGACG00000006699   Transcript: ENSGACT00000008888
Sequence length 376
Comment pep:novel group:BROADS1:groupVIII:7128424:7130300:-1 gene:ENSGACG00000006699 transcript:ENSGACT00000008888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKMLRLTVVVAFLGGLNLVLSSSSCPAVCDCPLEMPKCAPGVSVVLDGCGCCKVCARQLN
EDCGLTEPCDHTKGLECNFGASFAAATTRGICRAKSEGRPCEYNSRIYQNGESFQPNCKH
QCTCIDGAVGCVPLCPQELSLPNLGCASPRLVKVAGQCCEEWVCDDGKETDILEKIFGKD
MKTDDLERGLTNRNELIAIVKGGLKSLAAFRPQPEVHIFDNQKCIVQTTPWSQCSKSCGT
GISTRVTNNNSDCKLVKETRICEVRLCTQSPYSSLKKGKKCSRTKKSSQPVKFTYAGCSS
LKKYRPKYCGACMDGRCCSPHDTRTIRVKFRCEDGETFNKNIMMIESCKCTYNCPNANEA
SYPFYRLSNDIHKFRD
Download sequence
Identical sequences G3NU51
ENSGACP00000008869 69293.ENSGACP00000008869 ENSGACP00000008869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]